ESTScan Details for Unigene SGN-U314791

Score 
922
Direction 
Forward
Predicted Peptide Sequence 
YLLLLLIANTEREREKLPKRRCKELFLTLCFSVEKGKVLNLGGREERGANVKNETRPXEQIKKQMGNCGTREESAVVSNAHHQVQQQQGL
SLGSRIGIDSKKHSHSRSTSDLSDPSTPRNLEDFRKNAVLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
VAVKVLNKEGLQGHREWLTEVNFLGQLRHSNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRATVSLSWATRMMIALGAAKGLAFLHN
AERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTR
PSKEQNLVDWARPKLNDKRKMLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSSGGSTNEASSTGTAVRFAI
GKVPDYRTHHRYGSSLGTAAGCRSPNPNCSPGGPAACRVDKEHDITECSFGCTAVLYFWM
Predicted Coding Sequence 
XACTATCTACTTCTCCTGCTAATTGCAAATACAGAGAGAGAGAGAGAAAAACTACCCAAACGTCGCTGTAAAGAGCTCTTTTTGACTCTC
TGTTTTAGTGTAGAAAAGGGTAAAGTGTTGAATTTGGGAGGGAGGGAGGAGAGGGGTGCTAATGTGAAGAATGAGACTAGACCTAAXGAA
CAGATAAAGAAGCAGATGGGCAATTGTGGTACTAGAGAAGAATCTGCTGTTGTCTCCAATGCTCATCATCAAGTCCAGCAGCAGCAGGGG
TTATCGTTGGGAAGCAGGATAGGTATTGATTCAAAGAAACATAGTCATAGTCGTTCTACATCAGATCTGAGTGATCCTTCGACTCCGAGA
AACTTAGAGGATTTTAGAAAGAATGCTGTACTGTATACTCATATAATTGCATTTACTCTTTTTGAGCTGGAGACAATTACTAAAAGCTTC
CGATCTGATTATATACTTGGTGAGGGTGGTTTTGGAACTGTTTACAAGGGCTACATTGATGAGAATGTTCGTGTTGGACTTAAGTCTTTG
CCGGTTGCTGTCAAAGTACTTAACAAAGAGGGGCTTCAAGGTCACCGTGAGTGGCTTACTGAGGTCAACTTTCTTGGACAGCTTAGGCAT
TCTAATCTTGTCAAGTTGATCGGGTATTGCTGTGAGGATGACCATCGTTTGCTCGTTTATGAGTTCATGTTTAGAGGAAGCCTTGAGAAT
CATCTCTTCCGAAGGGCTACTGTGTCATTATCTTGGGCTACAAGAATGATGATTGCTCTTGGAGCAGCTAAAGGGCTTGCATTCCTTCAC
AATGCAGAAAGACCAGTTATCTATCGTGATTTCAAGACCTCAAATATATTATTGGATTCTGATTATACGGCCAAACTATCTGATTTCGGG
CTTGCAAAAGCAGGGCCACAAGGTGATGAGACCCATGTATCCACTCGTGTGATGGGTACCTATGGTTATGCAGCTCCAGAATATGTTATG
ACCGGACACCTTACTGCAAGAAGCGACGTGTACAGTTTTGGTGTAGTACTCCTAGAACTATTGACGGGAAGGAAGTCTGTTGACAAGACC
AGACCAAGCAAGGAACAGAATCTAGTTGACTGGGCTCGGCCAAAACTTAACGATAAGAGAAAAATGCTGCAGATTATAGACCCTAGATTA
GATAACCAATATTCAGTGAGGGCAGCTCAAAAAGCTTGCAGTTTGGCATACTATTGCCTGAGCCAAAACCCCAAAGCAAGACCCTTGATG
AGTGACGTAGTTGAAACTTTAGAGCCACTACAATCCAGCGGTGGCAGTACAAATGAAGCCTCATCAACTGGAACAGCTGTTCGATTTGCC
ATAGGAAAGGTCCCAGATTACAGAACACACCACCGTTATGGTAGCTCTCTTGGTACTGCAGCTGGTTGTCGGTCTCCCAACCCAAACTGT
TCCCCAGGTGGCCCTGCAGCATGCCGTGTTGATAAGGAACACGACATAACTGAATGTAGCTTTGGGTGTACTGCTGTTCTATACTTTTGG
ATGTAA
Edits in Original Sequence 
(5')XACTATCTACTTCTCCTGCTAATTGCAAATACAGAGAGAGAGAGAGAAAAACTACCCAAACGTgCGCTGTAAAGAGCTCTTTTTGA
CTCTCTGTTTTAGTGTAGAAAAGGGTAAAGTGTTGAATTTGGGAGGGAGGGAgGGAGAGGGGTGCTAATGTGAAGAATGAGACTAGACCT
AAXGAACAGATAAAGAAGCAGATGGGCAATTGTGGTACTAGAGAAGAATCTGCTGTTGTCTCCAATGCTCATCATCAAGTCCAGCAGCAG
CAGGGGTTATCGTTGGGAAGCAGGATAGGTATTGATTCAAAGAAACATAGTCATAGTCGTTCTACATCAGATCTGAGTGATCCTTCGACT
CCGAGAAACTTAGAGGATTTTAGAAAGAATGCTGTACTGTATACTCATATAATTGCATTTACTCTTTTTGAGCTGGAGACAATTACTAAA
AGCTTCCGATCTGATTATATACTTGGTGAGGGTGGTTTTGGAACTGTTTACAAGGGCTACATTGATGAGAATGTTCGTGTTGGACTTAAG
TCTTTGCCGGTTGCTGTCAAAGTACTTAACAAAGAGGGGCTTCAAGGTCACCGTGAGTGGCTTACTGAGGTCAACTTTCTTGGACAGCTT
AGGCATTCTAATCTTGTCAAGTTGATCGGGTATTGCTGTGAGGATGACCATCGTTTGCTCGTTTATGAGTTCATGTTTAGAGGAAGCCTT
GAGAATCATCTCTTCCGAAGGGCTACTGTGTCATTATCTTGGGCTACAAGAATGATGATTGCTCTTGGAGCAGCTAAAGGGCTTGCATTC
CTTCACAATGCAGAAAGACCAGTTATCTATCGTGATTTCAAGACCTCAAATATATTATTGGATTCTGATTATACGGCCAAACTATCTGAT
TTCGGGCTTGCAAAAGCAGGGCCACAAGGTGATGAGACCCATGTATCCACTCGTGTGATGGGTACCTATGGTTATGCAGCTCCAGAATAT
GTTATGACCGGACACCTTACTGCAAGAAGCGACGTGTACAGTTTTGGTGTAGTACTCCTAGAACTATTGACGGGAAGGAAGTCTGTTGAC
AAGACCAGACCAAGCAAGGAACAGAATCTAGTTGACTGGGCTCGGCCAAAACTTAACGATAAGAGAAAAATGCTGCAGATTATAGACCCT
AGATTAGATAACCAATATTCAGTGAGGGCAGCTCAAAAAGCTTGCAGTTTGGCATACTATTGCCTGAGCCAAAACCCCAAAGCAAGACCC
TTGATGAGTGACGTAGTTGAAACTTTAGAGCCACTACAATCCAGCGGTGGCAGTACAAATGAAGCCTCATCAACTGGAACAGCTGTTCGA
TTTGCCATAGGAAAGGTCCCAGATTACAGAACACACCACCGTTATGGTAGCTCTCTTGGTACTGCAGCTGGTTGTCGGTCTCCCAACCCA
AACTGTTCCCCAGGTGGCCCTGCAGCATGCCGTGTTaGATAAGGAACACGACATAACTGAATGTAGCTTTGGGTGTACTGCTGTTCTATA
CTTTTGGATGTAA(3')ATTGCAGGAGAAAGTATAGTCTTTTAAGCTTGTTGTGGTTCTTAAATGGGCAAATCTGTACCAGGTGAAGAGC
AATTAGCTGACACAGCTTTTGCTTCTTCCCTTTTTTTCCCTCCATTGTTGCCTCATCGAAGAATTGAATGTGTGTTTGAGTAAGTAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan