ESTScan Details for Unigene SGN-U314837

Score 
445
Direction 
Forward
Predicted Peptide Sequence 
ESEVRIMKRLRHPNVVLFMGAVTRSPHLSIVTEFLHRGSLYRLIHRPNNQLDERRRLRMALDAARGMNYLHNCTPMIVHRDLKSPNLLVD
KNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPDD
TDPAIADIIRKCWQTDPKLRPSFTEIMAALKPLQKPITSSHAPKPPVAQRPTIVNLRRCIRGAGLILKNVNRRIFXLNLNRSEFELKKLK
EDIKEPDSQILHFKPNCDSFVSSVSLSSKIVYLPSLVYSY
Predicted Coding Sequence 
XXAGAGAGTGAGGTGCGGATCATGAAAAGGCTCAGACATCCAAATGTTGTTCTGTTCATGGGAGCTGTTACTCGTTCTCCACATCTTTCA
ATTGTTACTGAGTTTCTTCATAGAGGAAGTTTGTACAGATTAATCCATCGACCCAACAATCAGTTAGATGAGCGCAGAAGGTTGAGGATG
GCTCTTGATGCTGCTCGAGGAATGAACTATTTACACAACTGCACTCCAATGATAGTTCATCGAGATTTGAAGTCACCAAATCTCCTAGTA
GATAAGAACTGGGTTGTGAAGGTATGTGATTTTGGACTGTCAAGAATGAAGCACAGCACATTTCTTTCTTCTAGGTCTACTGCTGGGACG
GCAGAGTGGATGGCCCCAGAAGTGCTGAGAAATGAACCTTCAAATGAAAAATGTGATGTATATAGCTTCGGTGTCATACTATGGGAGCTC
TGTACTTTACAGCAACCATGGGGAGGAATGAATCCAATGCAAGTCGTTGGCGCTGTGGGGTTTCAGCACCGTCGTCTTGACATACCAGAT
GACACGGATCCAGCTATTGCAGACATTATCAGGAAATGCTGGCAAACAGATCCAAAGTTACGGCCTTCATTTACTGAGATAATGGCTGCT
CTGAAACCACTACAAAAGCCTATTACTAGTTCACATGCACCAAAACCACCAGTTGCXCAGAGGCCAACCATCGTGAATCTTAGAAGATGC
ATCCGCGGAGCAGGGTTAATACTGAAGAACGTAAATAGACGTATTTTTCXGTTGAATTTAAACAGGTCCGAATTTGAGCTCAAGAAGCTG
AAAGAAGACATCAAAGAACCTGACAGTCAGATACTTCATTTTAAGCCAAATTGTGATTCTTTTGTTAGCAGTGTTTCCCTGTCCTCAAAA
ATTGTGTATCTGCCTTCCCTTGTGTATTCATATTGA
Edits in Original Sequence 
(5')XXAGAGAGTGAGGTGCGGATCATGAAAAGGCTCAGACATCCAAATGTTGTTCTGTTCATGGGAGCTGTTACTCGTTCTCCACATCT
TTCAATTGTTACTGAGTTTCTTCATAGAGGAAGTTTGTACAGATTAATCCATCGACCCAACAATCAGTTAGATGAGCGCAGAAGGTTGAG
GATGGCTCTTGATGCTGCTCGAGGAATGAACTATTTACACAACTGCACTCCAATGATAGTTCATCGAGATTTGAAGTCACCAAATCTCCT
AGTAGATAAGAACTGGGTTGTGAAGGTATGTGATTTTGGACTGTCAAGAATGAAGCACAGCACATTTCTTTCTTCTAGGTCTACTGCTGG
GACGGCAGAGTGGATGGCCCCAGAAGTGCTGAGAAATGAACCTTCAAATGAAAAATGTGATGTATATAGCTTCGGTGTCATACTATGGGA
GCTCTGTACTTTACAGCAACCATGGGGAGGAATGAATCCAATGCAAGTCGTTGGCGCTGTGGGGTTTCAGCACCGTCGTCTTGACATACC
AGATGACACGGATCCAGCTATTGCAGACATTATCAGGAAATGCTGGCAAACAGATCCAAAGTTACGGCCTTCATTTACTGAGATAATGGC
TGCTCTGAAACCACTACAAAAGCCTATTACTAGTTCACATGCACCAAAACCACCAGTTGCXCAGAGGCCAACCATCGTGAATCTTAGAAG
ATGCATCCGCGGAGCAGGGTTAATACTGAAGAACGTAAATAGACGTATTTTTCXGTTGAATTTAAACAGGTCCGAATTTGAGCTCAAGAA
GCTGAAAGAAGACATCAAAGAACCTGACAGTCAGATACTTCATTTTAAGCCAAATTGTGATTCTTTTGTTAGCAGTGTTTCCCTaGTCCT
CAAAAATTGTGTATCTGCCTTCCCTTGTGTATTCATATTGA(3')TTCCCTCTTTTGTAATTAAAAAAAAAGAAGAAAGAATTGCTTTAA
AGGAGCTCAAGCTCCTCTTTTATCTATGTTTTAGGTCAACATTTATATTTTGTACCTATTTTATTGAAACATGTGCAAATATAGCTCTTG
AG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan