Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U314885

Score 
2135
Direction 
Forward
Predicted Peptide Sequence 
MNKQRKLRQTHLTLYSSKTSDPDADPKRKAKTVTAQPAANDGDIDPAEEAGAGAGASAAIVVPMRKQTTTITARTDEVAFETAISVEKDT
EKSEXEMLTGGHYFSSAVPHMPNFSSLSFLCLKMGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYA
WVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQ
MICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLP
LQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAAS
FTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDM
RQTVAVGVVKNVDKKDPTGAKVTKAAQKKGKXNCAVDAGVSNAFIYIECAI
Predicted Coding Sequence 
ATGAATAAGCAGAGAAAATTGAGACAAACTCATCTCACTCTCTACTCTTCAAAAACTTCAGATCCTGATGCAGATCCGAAGAGGAAAGCG
AAAACAGTGACAGCACAGCCAGCGGCGAATGACGGAGACATAGATCCGGCGGAAGAAGCAGGTGCCGGTGCAGGTGCGTCGGCAGCTATT
GTAGTTCCGATGAGAAAACAAACAACGACAATTACAGCAAGGACTGATGAAGTTGCCTTCGAGACCGCCATTTCTGTTGAGAAGGATACT
GAGAAAAGTGAAGAXGAGATGTTAACTGGCGGGCATTATTTCTCCTCAGCTGTGCCGCATATGCCTAATTTTTCTTCTCTAAGTTTCTTG
TGTCTCAAGATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTG
ATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCC
TGGGTGCTTGACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGC
ACTGTTATTGATGCCCCCGGCCACAGGGATTTCATCAAGAACATGATCACTGGTACCTCTCAGGCTGACTGTGCTGTTCTCATTATTGAC
TCCACTACTGGTGGTTTTGAAGCTGGTATCTCCAAAGATGGTCAGACCCGTGAACATGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAA
ATGATCTGCTGCTGTAACAAGATGGATGCTACCACCCCCAAGTACTCCAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCCTAC
CTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCCTTTGTTCCAATCTCTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCAAC
CTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTTGACCAGATTAATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTCCA
CTTCAGGACGTTTACAAGATTGGTGGAATTGGAACTGTCCCCGTTGGTCGTGTTGAAACTGGTGTGATCAAGCCTGGTATGGTTGTGACC
TTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTTGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGG
TTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGC
TTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCTCCAGTGCTTGATTGTCACACTTCCCACATTGCT
GTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGTAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCT
GGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAGACCTTTGCTGAATACCCTCCATTGGGTCGTTTTGCTGTGAGGGACATG
AGGCAGACTGTTGCTGTTGGTGTTGTCAAGAATGTTGACAAGAAGGACCCAACTGGTGCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGG
AAGXTGAACTGTGCAGTTGATGCTGGTGTTTCGAATGCATTTATTTACATCGAGTGTGCTATCTAG
Edits in Original Sequence 
TTTTTTTTTTTATGAAAACAAATCTATATTACGCCAAAAAATAATTAATAAAATCGACAAAAAAAATGAAGAATCGCAGAATAGAGATTT
TTTTTTTCTGAAGTAGATCTATGAAATAAATTAGGTAAAATAAACTCAATACATAGGGCCGTCCAAAATATCATATATCAAAAAAGCTAC
TCTGGAAAACGCAGAAATAATCCATAGAACAGAAGAAATGCATAGACTATACATACACGAAGCAGTTCCTAGTAACATATCATATATTCA
TATACACCAGAAAACACGAAGAAATCTGAAATGCAAACA
(5')ATGAATAAGCAGtAGAAAATTGAGACAAACTCATCTCACTCTCTACT
CTTCAAAAACTTCAGATCCTGAgTGCAGATCCGAAGAGGAAAGCGAAAACAGTGACAGCACAGCCAGCGGCGAATGACGGAGACATAGAT
CCGGCGGAAGAAGCAGGTGCCGGTGCAGGTGCGTCGGCAGCTATTGTAGTTCCGATGAGAAAACAAACAACGACAATTACAGCAAGGACT
GATGAAGTTGCCTTCGAGACCGCCATTTCTGTTGAGAAGtGATACTGAGAAAAGTGAAGAXGAGATGTTAACTGGCGGGCATTATTTCTC
CTCAGCTGTGCCGCATATcGCCTAATTTTTCTTCTCTAAGTTTCTTaGTGTCTCAAGATGGGTAAAGAGAAGATTCACATCAGCATCGTG
GTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAGG
TTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCAGAACGTGAGCGTGGTATC
ACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTTATTGATGCCCCCGGCCACAGGGATTTCATCAAGAAC
ATGATCACTGGTACCTCTCAGGCTGACTGTGCTGTTCTCATTATTGACTCCACTACTGGTGGTTTTGAAGCTGGTATCTCCAAAGATGGT
CAGACCCGTGAACATGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATCTGCTGCTGTAACAAGATGGATGCTACCACCCCCAAG
TACTCCAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCCTACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCCTTTGTT
CCAATCTCTGGTTTTGAAGGAGACAACATGATTGAGAGGTCTACCAACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTTGAC
CAGATTAATGAGCCCAAGAGGCCATCAGACAAGCCCCTCCGTCTTCCACTTCAGGACGTTTACAAGATTGGTGGAATTGGAACTGTCCCC
GTTGGTCGTGTTGAAACTGGTGTGATCAAGCCTGGTATGGTTGTGACCTTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTTGAG
ATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGT
TATGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGCTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATT
GGAAATGGATATGCTCCAGTGCTTGATTGTCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCA
GGTAAGGAACTTGAGAAGGAGCCTAAGTTCTTGAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAG
ACCTTTGCTGAATACCCTCCATTGGGTCGTTTTGCTGTGAGGGACATGAGGCAGACTGTTGCTGTTGGTGTTGTCAAGAATGTTGACAAG
AAGGACCCAACTGGTGCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGGAAGXTGAACTGTGCAGTgTGATGCTGGTGTTTCGAATGCtAT
TTATTTACATCGAGTGTGCTATCTAG(3')ACTCTGTTTTATTTAATTCTGCTTTAGTTTGGTCTTTGAGTTGTGTATTAGGTTGTAGTT
CTCTGACTTGTATCTCAAGTATCCATTCTCAGAACTGGGTACTTGATAGGCGGTGGCGAGCATGATTTTGAGTCTGTTATCATTTGCTTT
TGTTGAGGTGCCTTGGTTTGTTTTCCATGGTGGCTCAGGATTTTTGTTGCTTTAATTTGAGATTTAAGTTTTCTACTCATTACGTTACAT
TTAAGTTAACATGTTACCTTTGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan