ESTScan Details for Unigene SGN-U314905

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
MDKLSIAIFFLFFAFSFARTPVTQQENDITNIKLPEFDATPTTNQIDKETQHVQDNEDHIPESRDKKNKVLPLTLVRLHSINRHFPDDLG
VLRDYAPPSFPSCRQPSEDDDDDFAHVFPGGSFLAAGEFCTRKRADLKAAPLTSXAFPNGISWAGVTTKVDIGETNPRERGILQTVNQTS
LQNLFTPNILNLDTLNNWKSIWIEIFIW
Predicted Coding Sequence 
ATGGATAAACTCTCCATTGCTATTTTCTTCCTTTTTTTCGCCTTTTCGTTTGCTCGAACACCAGTAACGCAACAAGAAAACGATATCACT
AACATCAAACTTCCAGAATTCGATGCCACCCCGACCACAAACCAGATTGACAAAGAAACTCAACATGTTCAAGACAATGAAGATCACATT
CCTGAATCTAGGGACAAAAAGAATAAGGTATTACCTTTGACGCTTGTTCGGCTTCATTCAATCAACCGCCACTTTCCGGATGATCTAGGC
GTCCTTCGCGATTATGCACCACCATCATTTCCATCATGCAGACAACCTTCTGAAGATGATGATGATGACTTTGCACATGTATTTCCTGGA
GGCAGTTTTTTGGCTGCTGGTGAGTTCTGCACAAGGAAAAGGGCTGACTTGAAGGCAGCTCCGCTAACATCTGXAGCATTTCCAAATGGA
ATTTCGTGGGCCGGGGTTACCACGAAGGTTGATATTGGAGAGACAAATCCCAGAGAAAGGGGAATTCTTCAAACCGTGAATCAAACCAGC
CTGCAAAACCTTTTCACCCCAAACATCCTTAATCTTGATACCCTTAACAACTGGAAGAGCATTTGGATTGAAATTTTCATCTGG
Edits in Original Sequence 
TTCTATTAAAGCGCAAATTTACACA(5')ATGGATAAACTCTCCATTGCTATTTTCTTCCTTTTTTTCGCCTTTTCGTTTGCTCGAACAC
CAGTAACGCAACAAGAAAACGATATCACTAACATCAAACTTCCAGAATTCGATGCCACCCCGACCACAAACCAGATTGACAAAGAAACTC
AACATGTTCAAGACAATGAAGATCACATTCCTGAATCTAGGGACAAAAAGAATAAGGTATTACCTTTGACGCTTGTTCGGCTTCATTCAA
TCAACCGCCACTTTCCGGATaGATCTAGGCGTCCTTCGCGATTATGCgACCACCATCATTTCCATCATGCAGACAACCTTCTGAAGATGA
TGATGATGACTTTGCACATGTATTTCCTGGAGGcCAGTTTTTTGGCTGCTGGTGAGTTCTGCACAAGGAAAAGGGCTGACTTGAAtGGCA
GCTCCGCTAACATCTGXAGCATTTCCAAATGGAATTTCGTGGGCCGGGGTTACCACGAAGGTTGATATTGGAGAGACAAATCCCAGAGAA
AGGGGAATTCTTCAAACCGTGAATCAAACCAGCCTGCAAAACCTTTTCACCCCAAACATCCTTAATCTTGATACCCTTAACAACTGGAAG
AGCATTTGGATTGAAATTTTCATCTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan