ESTScan Details for Unigene SGN-U315088

Score 
943
Direction 
Forward
Predicted Peptide Sequence 
MGNCLGSSARVDATLSSHNISASGASRIPSRTSHSSVLSSLSIPSYSRKSSADTLSTPRSEGEILFSPNVKSFSFNELKSATRNFRPDSL
LGEGGFGYVFKGWIDEHTLTAAKPGSGMVIAVKKLKPEGFQGHKEWVTEVNYLGQLRHPNLVKLIGYCIEGDDRLLVYEFMPKGSLENHL
FRRGPQPLTWLTRIKVAIGAARGLAFLHDAKEQVIYRDFKASNILLDGEFNAKLSDFGLAKAGPTGDRTHVSTQVIGTQGYAAPEYVATG
RLTSKSDVYSFGVVLLELLSGRRALDKMKVGVEQNLVDWAKPYLGDKRRLFRIMDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPRMSE
VLAALEQLQAPKGVNKISQIEHRATSSSVPASPFKHRSSLSVTPSASPLKAYHKRHAEGAPGK
Predicted Coding Sequence 
ATGGGTAACTGTTTAGGTTCATCAGCTAGAGTTGATGCCACTCTCAGCTCTCACAATATTTCTGCTTCCGGAGCCTCTAGGATTCCCAGC
AGAACCAGCCATTCTTCTGTTCTTTCAAGTCTAAGTATTCCATCTTATAGTCGGAAAAGCAGCGCTGATACTCTTTCTACTCCAAGATCT
GAAGGCGAGATTTTGTTTTCTCCCAATGTTAAGTCCTTCTCATTTAACGAATTGAAAAGTGCAACAAGGAACTTTAGACCTGACAGTCTT
CTTGGCGAAGGAGGATTTGGTTATGTTTTCAAAGGATGGATTGATGAACATACTCTTACTGCTGCAAAGCCTGGTTCTGGAATGGTCATT
GCGGTCAAGAAATTGAAGCCAGAGGGTTTTCAGGGTCACAAGGAGTGGGTGACTGAAGTTAATTACCTTGGCCAACTTCGTCATCCAAAT
CTGGTTAAACTCATTGGCTATTGTATAGAGGGAGATGATCGGCTTTTGGTGTATGAGTTCATGCCTAAAGGAAGCTTGGAGAATCATTTA
TTTCGAAGAGGGCCTCAACCTCTTACTTGGTTGACAAGAATTAAGGTGGCTATTGGTGCTGCTAGAGGCCTTGCTTTCCTACATGATGCT
AAAGAACAAGTTATATATCGGGATTTTAAGGCTTCTAATATTCTCTTAGACGGGGAATTTAATGCAAAGTTGTCTGATTTTGGTTTAGCC
AAGGCCGGCCCAACTGGTGATCGCACTCATGTGTCCACTCAAGTCATCGGTACTCAGGGCTATGCTGCTCCAGAATATGTTGCTACAGGT
CGATTGACATCAAAAAGTGATGTATACAGCTTCGGGGTTGTATTGCTTGAACTTTTATCAGGGCGTCGTGCTCTCGATAAAATGAAGGTT
GGCGTAGAGCAGAATCTTGTGGATTGGGCAAAGCCATATCTTGGGGACAAGAGGAGGTTGTTCCGAATCATGGACACTAAACTAGAGGGA
CAGTATCCTCAGAAAGGAGCATATACAGCTGCTAACCTTGCTTGGCAGTGTCTAAGCAACGAGCCTAAGCTAAGGCCGCGGATGTCTGAA
GTTTTGGCTGCTCTTGAACAGCTTCAAGCACCGAAAGGCGTTAACAAAATATCTCAGATTGAGCATCGAGCCACTTCTAGCTCAGTTCCA
GCTTCTCCATTTAAACACCGTTCATCACTCAGCGTGACACCCTCTGCGTCTCCATTAAAGGCCTATCATAAGCGCCACGCGGAAGGTGCT
CCAGGAAAATAA
Edits in Original Sequence 
GCTGTCATACCAAAAAGGACAAATTTTTGTCTAGCTTTTTTCAAGTATATTATTTTTTTTAATTTTCTCAATTGAAAAGAAACATATATA
CACCTATGTTTTATCTTTCTTGAAATTCGAAAAATTTTAACAAAAAATTATTCTTGTAAACACTTGTGCAGTGTTTCTTTTGCTGTTGTT
TTGTTTTACAG
(5')ATGGGTAACTGTTTAGGTTCATCAGCTAGAGTTGATGCCACTCTCAGCTCTCACAATATTTCTGCTTCCGGAGCC
TCTAGGATTCCCAGCAGAACCAGCCATTCTTCTGTTCTTTCAAGTCTAAGTATTCCATCTTATAGTCGGAAAAGCAGCGCTGATACTCTT
TCTACTCCAAGATCTGAAGGCGAGATTTTGTTTTCTCCCAATGTTAAGTCCTTCTCATTTAACGAATTGAAAAGTGCAACAAGGAACTTT
AGACCTGACAGTCTTCTTGGCGAAGGAGGATTTGGTTATGTTTTCAAAGGATGGATTGATGAACATACTCTTACTGCTGCAAAGCCTGGT
TCTGGAATGGTCATTGCGGTCAAGAAATTGAAGCCAGAGGGTTTTCAGGGTCACAAGGAGTGGGTGACTGAAGTTAATTACCTTGGCCAA
CTTCGTCATCCAAATCTGGTTAAACTCATTGGCTATTGTATAGAGGGAGATGATCGGCTTTTGGTGTATGAGTTCATGCCTAAAGGAAGC
TTGGAGAATCATTTATTTCGAAGAGGGCCTCAACCTCTTACTTGGTTGACAAGAATTAAGGTGGCTATTGGTGCTGCTAGAGGCCTTGCT
TTCCTACATGATGCTAAAGAACAAGTTATATATCGGGATTTTAAGGCTTCTAATATTCTCTTAGACGGGGAATTTAATGCAAAGTTGTCT
GATTTTGGTTTAGCCAAGGCCGGCCCAACTGGTGATCGCACTCATGTGTCCACTCAAGTCATCGGTACTCAGGGCTATGCTGCTCCAGAA
TATGTTGCTACAGGTCGATTGACATCAAAAAGTGATGTATACAGCTTCGGGGTTGTATTGCTTGAACTTTTATCAGGGCGTCGTGCTCTC
GATAAAATGAAGGTTGGCGTAGAGCAGAATCTTGTGGATTGGGCAAAGCCATATCTTGGGGACAAGAGGAGGTTGTTCCGAATCATGGAC
ACTAAACTAGAGGGACAGTATCCTCAGAAAGGAGCATATACAGCTGCTAACCTTGCTTGGCAGTGTCTAAGCAACGAGCCTAAGCTAAGG
CCGCGGATGTCTGAAGTTTTGGCTGCTCTTGAACAGCTTCAAGCACCGAAAGGCGTTAACAAAATATCTCAGATTGAGCATCGAGCCACT
TCTAGCTCAGTTCCAGCTTCTCCATTTAAACACCGTTCATCACTCAGCGTGACACCCTCTGCGTCTCCATTAAAGGCCTATCATAAGtCG
CCACGCGGAAGGTGaCTCCAGGAAAATAA(3')ACTTATATTTTGTTGTCATTGTAAAGTTTTCCTATATGTAACCAATTTTGTTGTCTA
GATGCATTGATATGTAGAATCAACAGATTGTTTCAACGTAAAATGTTGGAAATATCACTCTGTAACCTATTGATTGATGAGTTAGCTCTT
CTGCTCGTTGGGTACAATTAAAAAAAATTTCACATAATGGGTTTTTTTCTTCTTCTTGAATTATTATGTCCATACCCTTAACCCCACCTT
CATTTAGCAAGACTGCACGAGAATGGATTCAGAATTTAACCTTTATACCTTTATTGATTTGAGTTCAAGAATTTATTGTAACTTATTTAA
CTTACTAGTTCTAAAGTCAATTATTTATATTACTAAGTGAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan