ESTScan Details for Unigene SGN-U315191

Score 
1056
Direction 
Forward
Predicted Peptide Sequence 
IYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPPPVKPYHPTPVYKYPPPPTPVYMSPPPPVKPYHPTPVYNSPPPPTPVYMSPPPPVKPY
HPTPVYKSPPPPTPVYKSPPPPVKPYHPSPTPHHPTPVYKSSPPHYIYSSPPPPPPLLRSDFFIIYEEKHNVEVKGGIFIYERQ
Predicted Coding Sequence 
XCAATTTACAAGTCACCTCCACCACCAGTGAAGCCATACCATCCTGCACCAGTATACAAGTCTCCACCACCACCAACTCCAGTTTATAAG
TCACCACCACCACCGGTGAAGCCATACCATCCTACACCTGTGTACAAGTATCCACCACCACCAACTCCTGTTTACATGTCCCCACCACCA
CCAGTGAAGCCATACCATCCTACACCTGTGTACAATTCTCCACCACCACCAACTCCCGTTTACATGTCCCCACCACCACCAGTGAAGCCA
TATCATCCTACACCTGTGTACAAATCTCCACCACCACCAACTCCCGTTTACAAATCACCACCACCACCCGTGAAGCCATACCATCCTTCA
CCAACACCACACCATCCTACACCAGTATACAAGTCTTCACCACCCCACTATATTTATTCCTCTCCCCCTCCTCCXCCACCATTACTAAGA
AGTGACTTCTTCATTATATACGAGGAAAAGCATAATGTTGAGGTCAAAGGAGGCATTTTCATTTACGAGAGACAATGATAA
Edits in Original Sequence 
(5')XCAATTTACAAGTCACCTCCACCACCAGTGAAGCCATACCATCCTGCACCAGTATACAAGTCTCCACCACCACCAACTCCAGTTTA
TAAGTCACCACCACCACCGGTGAAGCCATACCATCCTACACCTGTGTACAAGTATCCACCACCACCAACTCCTGTTTACATGTCCCCACC
ACCACCAGTGAAGCCATACCATCCTACACCTGTGTACAATTCTCCACCACCACCAACTCCCGTTTACATGTCCCCACCACCACCAGTGAA
GCCATATCATCCTACACCTGTGTACAAATCTCCACCACCACCAACTCCCGTTTACAAATCACCACCACCACCCGTGAAGCCATACCATCC
TTCACCAACACCACACCATCCTACACCAGTATACAAGTCTTCACCACCCCACTATATTTATTCCTCTCCCCCTCCTCCXCCACCATTACT
AAGAAGTGACTTCTTCATTATATACGAGGAAAAGCATAATGTTGAGGTCAAAGGAGGCATTTTCATTTACGAGAGACAATGATAA(3')A
AAGAAGAAAATTAAATTTTATATAGTAAATAATAAGGCGGAGTTCTTTTGTAGCTTCATTTTATCTAATTTAGTGATATTGTTTTTGTAC
TCTATTTTTATATTTTATTTTTATGTCTTTGGGTATGTTTGTTCGATCTCCTTGCTAAATGCGGAGATTATGAGATGAATAAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan