ESTScan Details for Unigene SGN-U315207

Score 
726
Direction 
Forward
Predicted Peptide Sequence 
AIGGQSAEFFKNVKASASGIGTHGEXEINNNPLWQSRRPRQIIHITSHTAPFNFQLHEEYXPVSTASNSSGSRAAPIFVQIFFIYLALTP
SRTTVKPAAKETEKMPGIKGPSDYSREPPRHPSLKINAKEPFNAEPTRSALISSYVTPVDFFYKRNHGPIPVVDDIERYSVSLSGLIKNS
KDLFMKDICKLPKHTVTATLQCAGNRRTAMSKSRTVKGVGWDIAALGNAVWGGAKLADVLELVGIPYLASITQSGGKHVEFVSIDKCKEE
NGGPYKASIPLSQATNPEADVLLAYEMNGEPLNRDHGYPLRVVVPGVIGARSVKWLDSINIIAEECKGFFMQKDYKMFPPTVNWDNINWS
TRRPQMDFPVQSAICSLEDVSVVKHGKINIKGYALSGGGRGIERVDVSIDGGKTWEEATRYQRTGVPYIADDSSSDRWAWVFFEAEANIP
QSAEIVAKAVDISANVQPESIDSVWNLRGILNTSWHRVHVRVGQANLXGCVWCVEADDSNQHIRPWLFVSFLLKMKIAGGLRLPSLK
Predicted Coding Sequence 
XXGGCGATTGGCGGCCAATCGGCCGAATTCTTCAAGAACGTTAAGGCTTCXGCTAGTGGAATTGGTACACACGGTGAAAXTGAAATAAAC
AATAATCCACTGTGGCAATCGAGGCGACCTCGACAAATTATCCACATCACAAGTCACACAGCACCGTTTAATTTCCAATTGCATGAAGAG
TATAAXCCTGTCTCCACAGCCTCAAATTCGTCAGGTAGTAGGGCCGCTCCAATATTTGTACAAATCTTCTTCATCTACCTCGCACTCACA
CCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGGATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCT
CGCCATCCTTCTCTTAAAATTAATGCCAAGGAACCCTTTAATGCTGAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCCTGTT
GATTTCTTTTACAAGAGAAACCACGGACCCATACCAGTAGTGGATGACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATAAAAAAT
TCCAAAGACTTGTTTATGAAGGATATTTGTAAGCTTCCAAAACATACGGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAACTGCT
ATGAGTAAGAGTCGAACAGTGAAAGGAGTTGGTTGGGATATTGCTGCTTTAGGAAATGCTGTTTGGGGTGGAGCCAAATTGGCAGATGTT
CTAGAATTAGTTGGAATACCTTATTTGGCAAGTATCACACAATCTGGAGGAAAACATGTGGAATTTGTGAGCATTGACAAGTGTAAGGAG
GAAAATGGAGGTCCTTATAAGGCATCAATTCCATTGAGTCAGGCTACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAATGGA
GAGCCACTTAATAGGGATCATGGCTATCCACTGCGTGTGGTTGTCCCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTCCATC
AATATCATTGCCGAAGAATGCAAGGGATTCTTTATGCAAAAAGACTACAAGATGTTTCCACCAACAGTGAATTGGGATAACATCAACTGG
TCTACTAGGAGACCGCAGATGGACTTTCCTGTTCAGAGCGCAATATGTTCCCTGGAGGATGTGAGTGTTGTAAAGCATGGAAAGATAAAC
ATCAAGGGGTACGCATTATCAGGAGGTGGGCGTGGCATAGAAAGGGTAGACGTGTCTATAGATGGTGGTAAAACTTGGGAGGAAGCCACC
AGATACCAGAGAACTGGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAAATATT
CCCCAGAGTGCGGAAATAGTTGCTAAAGCGGTGGATATATCTGCAAATGTCCAACCTGAAAGTATAGATTCTGTCTGGAATCTGAGAGGA
ATCCTGAACACCTCATGGCATCGGGTTCATGTCCGAGTTGGTCAAGCAAATCTTXTAGGCTGTGTTTGGTGTGTTGAAGCGGATGACAGT
AATCAGCATATCAGGCCATGGTTGTTTGTATCCTTCTTGCTTAAAATGAAAATAGCTGGTGGTTTGCGTCTTCCTAGCTTAAAATGA
Edits in Original Sequence 
(5')XXGGCGATTGGCGGCCAATCGGCCGAATTCTTCAAGAACGTTAAGGCTTCXGCTAGTGGAATTGGTACACACGGTGAAAXTGAAAT
AAACAATAATCCACTGTGGCAATCGAGGCGACCTCGACAAATTATCCACATCACAAGTCACACAGCACCGTTTAATTTCCAATTGCATGA
AGAGTATAAXCCTGTCTCCACAGCCTCAAATTCGTCAGGTAGTAGGGCCGCTCCAATATTTGTACAAATCTTCTTCATCTACCTCGCACT
CACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGGATTAAAGGGCCTTCCGATTATTCGCGAGAACC
CCCTCGCCATCCTTCTCTTAAAATTAATGCCAAGGAACCCTTTAATGCTGAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCC
TGTTGATTTCTTTTACAAGAGAAACCACGGACCCATACCAGTAGTGGATGACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATAAA
AAATTCCAAAGACTTGTTTATGAAGGATATTTGTAAGCTTCCAAAACATACGGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAAC
TGCTATGAGTAAGAGTCGAACAGTGAAAGGAGTTGGTTGGGATATTGCTGCTTTAGGAAATGCTGTTTGGGGTGGAGCCAAATTGGCAGA
TGTTCTAGAATTAGTTGGAATACCTTATTTGGCAAGTATCACACAATCTGGAGGAAAACATGTGGAATTTGTGAGCATTGACAAGTGTAA
GGAGGAAAATGGAGGTCCTTATAAGGCATCAATTCCATTGAGTCAGGCTACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAA
TGGAGAGCCACTTAATAGGGATCATGGCTATCCACTGCGTGTGGTTGTCCCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTC
CATCAATATCATTGCCGAAGAATGCAAGGGATTCTTTATGCAAAAAGACTACAAGATGTTTCCACCAACAGTGAATTGGGATAACATCAA
CTGGTCTACTAGGAGACCGCAGATGGACTTTCCTGTTCAGAGCGCAATATGTTCCCTGGAGGATGTGAGTGTTGTAAAGCATGGAAAGAT
AAACATCAAGGGGTACGCATTATCAGGAGGTGGGCGTGGCATAGAAAGGGTAGACGTGTCTATAGATGGTGGTAAAACTTGGGAGGAAGC
CACCAGATACCAGAGAACTGGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAAA
TATTCCCCAGAGTGCGGAAATAGTTGCTAAAGCGGTGGATATATCTGCAAATGTCCAACCTGAAAGTATAGATTCTGTCTGGAATCTGAG
AGGAATCCTGAACACCTCATGGCATCGGGTTCATGTCCGAGTTGGTCAAGCAAATCTTXTAGGCTGTGTTTGGTGTGTTGAAGCGGATGA
CAGTAATCAGCATATCAGGCCATGGTTGTTTGTATCCTTCTTaGCTTAAAATGAAAATAGCaTGGTGGTTTGCGTCTTCCTAGCTTAAAA
TGA(3')AAATAAAATGTTCTCTTGATGTTGTCTCGAAATACTTACGGAAATAATAATAATTTGGAAGTGATTGCATCTTGACAAAAAAA
AAAAAAAAAATCTTCTCCAGTTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGGGGGGGAGAGAACTAGTCT
CGAGGGGGGGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan