ESTScan Details for Unigene SGN-U315249

Score 
459
Direction 
Reverse
Predicted Peptide Sequence 
MNPQDDISNSVGLHMYPKHYRGLELHLSVHCSAHHFGKLFFRRPIVLSLPGAFGLPLIPNSVFGGGASSEMGATNPGLPSSITASTNPYS
LDSQAFIKLSRSVSTSIFSKGWPVTLDSILLSFIFWYPISQKMLLPSSSYGPFPWYPDYSIPCDSSKSFADTLKALGVKAECILYEGKTH
TDLFLQDPMRGGIDDMLDDLITLIHGDSSETIKAKSTPRKRLVPEFMLQMARSVSPFXRSFYYCSKPIVFNWTRFELHEXARAFD
Predicted Coding Sequence 
ATGAATCCTCAAGACGACATCTCAAATTCAGTAGGACTACACATGTATCCCAAACATTATAGAGGACTGGAGCTTCATCTTTCTGTTCAT
TGCTCTGCTCATCATTTTGGAAAACTTTTCTTCAGAAGGCCAATTGTTCTTTCTCTTCCTGGTGCCTTCGGCCTTCCACTTATACCAAAC
TCTGTTTTTGGTGGAGGTGCGTCATCGGAAATGGGTGCTACCAATCCTGGTTTGCCGTCATCTATAACAGCATCAACCAACCCGTATTCC
TTAGACTCCCAAGCATTCATAAAATTATCACGATCAGTATCCACTTCAATCTTTTCTAAAGGCTGGCCTGTAACTCTTGATAGTATTTTA
TTAAGCTTCATCTTCTGGTATCCCATTTCTCAAAAGATGCTTCTCCCTTCTTCCTCCTATGGTCCTTTTCCATGGTACCCAGATTATTCC
ATTCCGTGTGATTCCAGCAAGAGTTTTGCTGATACTCTTAAAGCTCTCGGTGTCAAAGCAGAATGTATCCTATATGAAGGAAAGACACAT
ACAGATTTGTTTCTTCAGGATCCAATGAGAGGTGGAATAGATGATATGTTAGATGATCTAATTACACTGATTCATGGTGATAGCTCTGAA
ACCATCAAAGCAAAATCGACCCCAAGAAAACGCCTTGTACCTGAGTTCATGTTGCAGATGGCTCGAAGTGTTAGCCCCTTTTAACGATCA
TTCTACTACTGTTCCAAACCCATTGTGTTCAATTGGACTCGTTTTGAGCTCCATGAAXTCGCCAGAGCTTTCGATTAG
Edits in Original Sequence 
TTTTTTTTTTTTTTTTACCATTTCAAATGTTCTCTTTGTTGATAAACCTTTTGTTCAAATACTAAGAGGAGACACTGATACAACAGAAGG
CTCAACTGACGTCGACCATAATATAAAAAATACTGCAATAATCTACA
(5')ATGAATCCTCAAGACGACATCTCAAATTCAGTAGGACTA
CACATGTATCCCAAtACATTATAGAGGACTGaGAGCTTCATCTTTCTGTTCATTGCTCTGCTCATCATTTTGGAAtAACTTTTCTTCAGA
AGGCCAATTGTTCTTTCTCTTCCTGGTGCCTTCGGCCTTCCACTTATACCAAACTCgTGTTTTTGGTGGAGGTGCGTCATCGGAAATGGG
TGCTACCAATCCTGGTTTGCCGTCATCTATAACAGCATCAACCAACCCGTATTCCTTAGACTCCCAAGCATTCATAAAATTATCACGATC
AGTATCCACTTCAATCTTTTCTAAAGGCTGGCCTGTAACTCTTGATAGTATTTTATTAAGCTTCATCTTCTGGTATCCCATTTCTCAAAA
GATGCTgTCTCCCTTCTTCCTCCTATGGTCCTTTTCCATGGTACCgCAGATTATTCCATTCCGTGTGATTCCAGCAAGAGTTTTGCTGAT
ACTCTTAAAGCTCTCGGTGTCAAAGCAGAATGTATCCTATATGAAGGAAAGACACATACAGATTTGTTTCTTCAGGATCCAATGAGAGGT
GGAATAGATGATATGTTAGATGATCTAATTACACTGATTCATGGTGATAGCTCTGAAACCATCAAAGCAAAATCGACCCCAAGAAAACGC
CTTGTACCTGAGTTCATGTTGCAGATGGCTCGAAGTGTTAGCCCCTTTTAACGATCATTCTACTACTGTTCCAtAACCCATTGTGTTCAA
TTGGACTCGTTTTGAGCTCCATGAAXTCGCCAGAGCTTTCGATTAG(3')ATCCTCTTTTTTCCTTGTTATAGTTAGTTTAAAGTGGACT
TGCTAACAAAAGTAGCCATATATACAAATAGGTTATTCTTGGAAGGGAAAAAACCCTTCATTCAATTATTCTTATTGTAATATACTTAAT
ACTTCCAAGTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan