ESTScan Details for Unigene SGN-U315262

Score 
1081
Direction 
Forward
Predicted Peptide Sequence 
AGKGGQDEYEEATDADWGESLDIGEVENLQNGDISMVLGDEEGQEGNDEEEGGWDLEDLDLPSDADTPKTTSNARSSVFVTPTPGMPVSQ
IWVQKSSLAAEHAAAGNFDTAMRLLSRQLGIRNFSPLKSLFIDLHVGSHTHLLAFSSAPVISVAIERGWSESASPNVRGPPALIFSFAQL
EEKLKASYKATTGGKFSDALRLFLSILHTIPLIVIESRREVDEVKELIVIVKEYVLGLQMELKRKELKDNPIRQQELAAYFTHCNLQLPH
LRLALQNAMSICYKAGNLSSAANFARRLLETNPTNESQARTARQVLQAAEKNMRDVTQLNYDFRNPFTVCGATYVPIYRGQKDVTCPYCG
THFVLSQQGGLCTVCDLAVVGADASGXALLGITDQVISASHX
Predicted Coding Sequence 
GCAGGCAAGGGAGGACAAGACGAATATGAAGAGGCTACGGATGCAGACTGGGGTGAGTCATTGGACATCGGTGAGGTGGAAAATCTACAG
AATGGGGACATCAGTATGGTGCTTGGTGATGAGGAAGGACAAGAAGGAAATGATGAGGAGGAGGGAGGATGGGATCTTGAGGATCTGGAT
CTGCCTTCTGATGCAGACACACCTAAGACTACTTCCAATGCTCGTTCTTCTGTGTTTGTCACCCCAACACCTGGCATGCCTGTCAGCCAG
ATTTGGGTCCAAAAATCATCTCTAGCTGCTGAACATGCAGCTGCTGGAAATTTTGATACTGCTATGCGGTTGTTGAGTAGACAACTAGGG
ATTAGGAACTTCTCTCCTTTAAAATCACTGTTTATTGATCTTCATGTGGGTAGCCACACTCATCTGCTTGCCTTTTCCTCGGCGCCGGTC
ATCTCCGTGGCAATTGAGAGAGGTTGGAGTGAGTCAGCTAGTCCTAATGTTCGAGGTCCACCTGCTCTTATATTCAGTTTTGCTCAGTTG
GAGGAAAAACTTAAAGCTTCTTATAAAGCGACTACTGGTGGAAAATTTTCTGATGCACTTAGACTATTCCTGAGCATCCTTCACACCATT
CCTCTGATTGTGATTGAGTCGAGACGAGAAGTGGATGAAGTAAAGGAATTGATTGTCATAGTGAAAGAGTATGTTTTGGGTTTGCAGATG
GAGCTTAAGAGGAAGGAATTGAAAGACAATCCTATTCGCCAGCAGGAACTGGCAGCCTATTTCACTCACTGTAATCTGCAGCTTCCTCAC
TTGAGACTGGCGTTACAGAATGCTATGTCTATCTGCTACAAGGCCGGAAATCTTAGCTCAGCAGCGAACTTTGCTAGAAGACTCTTGGAG
ACCAATCCCACCAATGAAAGCCAAGCCAGAACAGCCCGCCAGGTTCTGCAAGCAGCTGAGAAAAATATGCGAGATGTTACACAGTTGAAT
TATGATTTCAGAAATCCTTTTACAGTGTGTGGGGCAACATATGTCCCGATATACCGGGGTCAGAAGGATGTCACTTGTCCTTACTGTGGT
ACTCATTTTGTACTGTCTCAGCAAGGGGGGCTTTGTACTGTTTGTGATCTTGCAGTTGTTGGAGCTGATGCCTCTGGTXTTGCTTTGCTC
GGCATCACAGATCAGGTGATTTCAGCTTCTCATGXX
Edits in Original Sequence 
(5')GCAGGCAAGGGAGGACAAGACGAATATGAAGAGGCTACGGATGCAGACTGGGGTGAGTCATTGGACATCGGTGAGGTGGAAAATCT
ACAGAATGGGGACATCAGTATGGTGCTTGGTGATGAGGAAGGACAAGAAGGAAATGATGAGGAGGAGGGAGGATGGGATCTTGAGGATCT
GGATCTGCCTTCTGATGCAGACACACCTAAGACTACTTCCAATGCTCGTTCTTCTGTGTTTGTCACCCCAACACCTGGCATGCCTGTCAG
CCAGATTTGGGTCCAAAAATCATCTCTAGCTGCTGAACATGCAGCTGCTGGAAATTTTGATACTGCTATGCGGTTGTTGAGTAGACAACT
AGGGATTAGGAACTTCTCTCCTTTAAAATCACTGTTTATTGATCTTCATGTGGGTAGCCACACTCATCTGCTTGCCTTTTCCTCGGCGCC
GGTCATCTCCGTGGCAATTGAGAGAGGTTGGAGTGAGTCAGCTAGTCCTAATGTTCGAGGTCCACCTGCTCTTATATTCAGTTTTGCTCA
GTTGGAGGAAAAACTTAAAGCTTCTTATAAAGCGACTACTGGTGGAAAATTTTCTGATGCACTTAGACTATTCCTGAGCATCCTTCACAC
CATTCCTCTGATTGTGATTGAGTCGAGACGAGAAGTGGATGAAGTAAAGGAATTGATTGTCATAGTGAAAGAGTATGTTTTGGGTTTGCA
GATGGAGCTTAAGAGGAAGGAATTGAAAGACAATCCTATTCGCCAGCAGGAACTGGCAGCCTATTTCACTCACTGTAATCTGCAGCTTCC
TCACTTGAGACTGGCGTTACAGAATGCTATGTCTATCTGCTACAAGGCCGGAAATCTTAGCTCAGCAGCGAACTTTGCTAGAAGACTCTT
GGAGACCAATCCCACCAATGAAAGCCAAGCCAGAACAGCCCGCCAGGTTCTGCAAGCAGCTGAGAAAAATATGCGAGATGTTACACAGTT
GAATTATGATTTCAGAAATCCTTTTACAGTGTGTGGGGCAACATATGTCCCGATATACCGGGGTCAGAAGGATGTCACTTGTCCTTACTG
TGGTACTCATTTTGTACTGTCTCAGCAAGGGGGGCTTTGTACTGTTTGTGATCTTGCAGTTGTTGGAGCTGATGCCTCTGGTXTTGCTTT
GCTCGGCATCACAGATCAGGTGATTTCAGCTTCTCATGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan