ESTScan Details for Unigene SGN-U315383

Score 
543
Direction 
Forward
Predicted Peptide Sequence 
LTLYAVTTPKPLTVFAATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCXVYRLASDXSLNFELIE
MLMNWNSSCNEPIXNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNA
GGRLACGVVGLTPI
Predicted Coding Sequence 
XCTTTGACCCTTTATGCTGTCACTACCCCTAAACCCCTTACTGTTTTTGCTGCTACTAAGAAAGCTGTTGCTGTCCTTAAGGGCAACTCT
AATGTTGAGGGGGTTGTCACTCTATCTCAAGATGATGATGGTCCAACTACGGTTAATGTTCGTATAACTGGACTTGCTCCTGGACTTCAC
GGGTTTCATTTACATGAATATGGTGACACTACAAACGGATGTXATGTCTACAGGTTAGCTTCTGATTTXAGTTTGAACTTTGAGTTAATC
GAAATGTTGATGAATTGGAACTCCTCTTGTAATGAGCCCATTXTTAATCCGAATAAATTGACACATGGAGCTCCTGGAGATGAAATCCGT
CATGCGGGTGACCTGGGAAACATAGTGGCCAATGCCGATGGCGTGGCTGAAGTGACACTTGTAGATAATCAGATACCATTGACCGGTCCA
AACTCAGTTGTTGGACGAGCACTTGTGGTTCATGAGCTTGAGGATGACCTCGGAAAGGGTGGCCATGAACTCAGTCTTACCACTGGCAAT
GCTGGTGGACGATTGGCATGCGGTGTGGTTGGTTTGACTCCAATATGA
Edits in Original Sequence 
(5')XCTTTGACCCTTTATGCTGTCACTACCCCTAAACCCCTTACTGTTTTTGCTGCTACTAAGAAAGCTGTTGCTGTCCTTAAGGGCAA
CTCTAATGTTGAGGGGGTTGTCACTCTATCTCAAGATGATGATGGTCCAACTACGGTTAATGTTCGTATAACTGGACTTGCTCCTGGACT
TCACGGGTTTCATTTACATGAATATGGTGACACTACAAACGGATGTXATGTCTACAGGTTAGCTTCTGATTTXAGTTTGAACTTTGAGTT
AATCGAAATGTTGATGAATTGGAACTCCTCTTGTAATGAGCCCATTXTTAATCCGAATAAATTGACACATGGAGCTCCTGGAGATGAAAT
CCGTCATGCGGGTGACCTGGGAAACATAGTGGCCAATGCCGATGGCGTGGCTGAAGTGACACTTGTAGATAATCAGATACCATTGACCGG
TCCAAACTCAGTTGTTGGACGAGCACTTGTGGTTCATGAGCTTGAGGATGACCTCGGAAAGGGTGGCCATGAACTCAGTCTTACCACTGG
CAATGCTGGTGGACGATTGGCATGCGGTGTGGTTGGTTTGACTCCAATATGA(3')AGTAAATGCAGCAGCAACAACAGCTCTTTTGTCG
GAATTATAATGAGTGAACGTATTTACCCTCCTCTCCGGGTTGCCAATAAACCTCTACATGAATTTGTACTGAGAAATTCTTTGATGAACT
AAATTTGAACTTGTATGTACACACTTGCCAACACTTTTTTGCTTCAAAACTGTAATTGGAGTTGGCTATTTACCTTCCTTTGTGTTTTGG
CTATCTAAAGTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan