ESTScan Details for Unigene SGN-U315610

Score 
303
Direction 
Forward
Predicted Peptide Sequence 
TQRRIRFQFSAPSAHLLLKFHRPSFSRPSPSATFSIFHLFSEANFMYIYRGVAIDYTDSKNCXGNFKIVEEKKKRGGMAPIVGSKQAEQL
KQDGNNYFQKNRFGAAIDAYTEAITLCPNVPIYWTNRALVIGGGMTGEEWRKIAGGAIQLDHNSVKAHYYLGLALLQKEAFGEGVRELEK
ALDLGRGANPGRYIVGEIWGRAAKAKYMEWEHVSTRRSWELQNLKESCESALKERHTLDSSQTEGLKDEKSTAAFEATGSSREVFVKAA
Predicted Coding Sequence 
ACGCAGCGTCGCATACGCTTCCAATTTTCTGCTCCTTCCGCACATTTGCTCTTGAAATTTCACAGACCATCCTTCTCCCGCCCCTCCCCG
TCGGCTACTTTTTCAATTTTCCACCTTTTTTCTGAAGCAAATTTCATGTATATATATAGAGGXGTAGCAATTGATTATACAGATTCTAAG
AACTGTGXTGGTAATTTCAAGATCGTAGAGGAAAAGAAAAAGAGAGGAGGAATGGCACCAATCGTGGGTTCAAAGCAAGCGGAACAACTA
AAGCAAGATGGGAACAATTATTTTCAGAAGAATCGGTTTGGGGCTGCCATTGATGCTTATACCGAGGCTATTACTTTGTGCCCTAATGTT
CCGATATATTGGACAAATCGTGCTCTTGTCATCGGAGGCGGAATGACTGGAGAAGAGTGGAGGAAGATTGCAGGAGGXGCGATTCAGCTC
GATCATAATTCTGTAAAGGCCCACTATTATCTTGGTCTTGCATTGCTACAAAAGGAAGCATTTGGTGAAGGTGTGAGAGAATTGGAAAAG
GCATTAGACCTTGGAAGAGGTGCGAATCCAGGAAGATATATTGTTGGAGAGATCTGGGGAAGAGCTGCTAAAGCAAAGTACATGGAGTGG
GAGCATGTATCTACAAGGCGCTCCTGGGAGCTTCAGAACTTGAAAGAATCATGTGAGTCAGCTCTCAAGGAGAGACATACGCTTGACAGT
TCTCAGACAGAAGGGCTCAAAGATGAAAAATCAACAGCXGCTTTTGAAGCAACTGGAAGCTCTAGGGAAGTTTTCGTGAAAGCTGCX
Edits in Original Sequence 
(5')ACGCAGCGTCGCATACGCTTCCAATTTTCTGCTCCTTCCGCACATTTGCTCTTGAAATTTCACAGACCATCCTTCTCCCGCCCCTC
CCCGTCGGCTACTTTTTCAATTTTCCgACCTTTTTTCTGAAGCAAATTTCATGTATATATATAGAGGXGTAGCAATTGATTATACAGATT
CTAAGAACTGTGXTGGTAATTTCAAGATCGTAGAGGAAAAGAAAAAGtAGAGGAGGAATGGCACCAATCGTGGGTTCAAAGCAAGCGGAA
CAACTAAAGCAAGATGGGAACAATTATTTTCAGAAGAATCGGTTTGGGGCTGCCATTGATGCTTATACCGAGGCTATTACTTTGTGCCCT
AATGTTCCGATATATTGGACAAATCGTGCTCTaTGTCATCGGAGGCGGAATGACTGGAGAAGAGTGGAGGAAGATTGCAGGAGGXGCGAT
TCAGCTCGATCATAATTCTGTAAAGGCCCACTATTATCTTGGTCTTGCATTGCTACAAAAGGAAGCATTTGGTGAAGGTGTGAGAGAATT
GGAAAAGGCATTAGACCTTGGAAGAGGTGCGAATCCAGGAAGATATATTGTTGGAGAGATCTGGGGAAGAGCtTGCTAAAGCAAAGTACA
TGGAGTGGGAGCATGTATCTACAAGGCGCTCCTGGGAGCTTCAGAACTTGAAAGAATCATGTGAGTCAGCTCTCAAGGAGAGACATACGC
TTGACAGTTCTCAGACAGAAGGGCTCAAAGATGAAAAATCAACAGCXGCTTTTGAAGCAACTGGAAGCTCTAGGGtAAGTTTTCGTGAAA
GCTGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan