ESTScan Details for Unigene SGN-U315649

Score 
186
Direction 
Forward
Predicted Peptide Sequence 
RKRNEILQLAVLGADLAILDKIDSGLDVDALRDVAKAVNGLLSPKNSVLMITHYLRLLEFIKPTYIHIMEKGRIVKTGDISIAKVLEKEG
YKAISAHRAAMKNDDFVSSAATRGNISTAPTLFKKVAISDASTFSSNDSKYQCSIVSRFKSKDNCXPPDVGKMTNFDXHGE
Predicted Coding Sequence 
AGGAAACGCAATGAGATTCTGCAACTAGCGGTTCTCGGGGCTGACTTGGCAATACTGGATAAGATTGATTCTGGTTTAGATGTTGACGCA
CTTCGAGACGTAGCAAAGGCAGTAAATGGACTTCTATCGCCAAAGAATTCAGTGTTGATGATTACTCATTACTTACGATTATTAGAATTC
ATCAAGCCGACGTATATCCATATCATGGAGAAAGGGAGAATCGTGAAGACTGGAGACATATCCATAGCTAAAGTTCTGGAGAAAGAAGGG
TACAAAGCAATTTCTGCCCATAGAGCTGCCATGAAGAATGATGATTTTGTCTCATCAGCTGCTACTAGAGGAAATATTTCTACTGCTCCA
ACATTATTTAAGAAAGTGGCAATTAGTGATGCTTCCACTTTCTCATCAAATGATTCAAAATATCAGTGCTCAATTGTCTCGAGATTTAAG
AGTAAGGATAACTGTGXTCCCCCTGATGTGGGCAAAATGACAAATTTTGATGXACATGGGGAATGA
Edits in Original Sequence 
(5')AGGAAACGCAATGAGATTCTGCAACTAGCGGTTCTCGGGGCTGACTTGGCAATACTGGATAAGATTGATTCTGGTTTAGATGTTGA
CGCACTTCGAGACGTAGCAAAGGCAGTAAATGGACTTCTATCGCCAAAGAATTCAGTGTTGATGATTACTCATTACTTACGATTATTAGA
ATTCATCAAGCCGACGTATATCCATATCATGGAGAAAGGGAGAATCGTGAAGACTGGAGACATATCCATAGCTAAAGTTCTGGAGAAAGA
AGGGTACAAAGCAATTTCTgGCCCATAGAGCTGCCATGAAGAATGATGATTTTGTCTCATCAGCTaGCTACTAGAGGAAATATTTCTACT
GCTCCAACATTATTTAAGAAAGTGGCAATTAGTGATGCTTCCACtTTTCTCATCAAATGATTCAAAATATCAGTGCTCAATTGTCTCGAG
ATTTAAGAGTAAGGATAACTGTGXTCCCCCTGATGTGGGCAAAATGACAAATTTTGATGXACATGGGGAATGA(3')GTCATATACTTGT
ATTTTATCCTGTCTTTTTTTTCTTCTAAAGATTAGTTTTGTATCGGGAATTATAGTAACTTATTTGGTTGGTTGCTGTCTAAATTCGGTG
AGGGTTCGATTCTCCACCTGTGCCTGATGATCTACTTTATGAGGAGAGGCCTTTTACCTCTTAATTCAGTTGTGTGCAATTGCTTTCTTG
GTCCCTTAGTTACTATAAAATTCTTATTTGGTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan