ESTScan Details for Unigene SGN-U315720

Score 
1882
Direction 
Forward
Predicted Peptide Sequence 
MDPMKLNQLKQFVEQCKSNPSILSDPSLSFFRDYIENLGAKLPPAAYDTGDYKEKSHAVDASDDEMDDDENDANIKETVEEEEEPEIIES
DIELDESDTVEPDNDEPQKMGDPSVEVTEESRDASQESKAEAMEAISEGKLEDAIEHLTKAVLLNPKSAIMYATRASVYIKMKKPNAAIR
DATAALELNPDSAKGYKSRGIARAMLGQWEAAAKDLHVASKLDYDEEISAVLKKVEPNAHRIEEHRRKYDRLRKEREDRKIERERQRRKA
EAQAAYEKAKKQEESSSRRAGGMPGGFPGGMPGGFPGGMPGSAPGGMPGGMPGAAPGGMPGNMDYSKILNDPELMAAFKDPDVMAALQDV
MKNPANLAKHQGNPKIAPIIAKMMGKFAGNN
Predicted Coding Sequence 
ATGGACCCGATGAAGTTGAATCAACTGAAGCAATTCGTTGAACAGTGCAAATCCAATCCTTCCATTCTCTCCGATCCTTCTCTTTCATTT
TTCCGTGACTACATTGAGAATCTCGGTGCTAAACTTCCTCCGGCTGCTTACGACACCGGCGATTACAAAGAGAAGTCCCATGCGGTGGAT
GCGAGTGATGATGAGATGGATGATGATGAGAATGATGCTAATATCAAAGAGACAGTTGAAGAAGAGGAGGAGCCTGAGATAATTGAATCT
GATATTGAGCTTGATGAGAGTGACACTGTGGAACCTGACAATGATGAGCCACAGAAGATGGGAGACCCTTCTGTGGAGGTGACTGAAGAA
AGCCGTGATGCTTCTCAGGAGTCCAAAGCTGAGGCCATGGAAGCAATTTCTGAAGGTAAGTTAGAAGATGCAATTGAGCATCTTACAAAG
GCAGTTCTCCTCAATCCTAAATCAGCAATTATGTATGCTACTAGAGCTAGTGTTTATATCAAGATGAAGAAGCCAAACGCTGCCATACGA
GATGCAACTGCAGCATTGGAGTTGAATCCAGATTCTGCTAAAGGTTACAAATCTCGTGGCATTGCCAGAGCCATGCTGGGACAGTGGGAG
GCAGCTGCTAAGGATCTTCATGTGGCTTCGAAGCTGGACTATGATGAGGAAATAAGTGCTGTGCTTAAGAAGGTTGAGCCCAATGCACAT
AGAATTGAAGAACACCGCAGGAAATATGATAGGTTGCGCAAAGAACGAGAAGATAGAAAGATTGAGCGTGAGAGACAACGAAGAAAGGCT
GAAGCTCAGGCTGCTTATGAAAAGGCCAAGAAGCAAGAAGAATCATCAAGTAGGAGAGCTGGTGGCATGCCTGGAGGCTTTCCAGGTGGC
ATGCCCGGAGGCTTTCCAGGGGGTATGCCTGGGTCTGCACCTGGAGGAATGCCCGGAGGCATGCCTGGGGCTGCACCTGGAGGAATGCCC
GGTAACATGGACTACAGCAAAATACTGAATGACCCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGATGTG
ATGAAGAACCCAGCTAATTTGGCCAAGCATCAAGGAAATCCTAAGATTGCTCCTATTATTGCAAAAATGATGGGCAAGTTTGCTGGAAAT
AATTGA
Edits in Original Sequence 
AGTAATAGAAGCTACTAGAAGAACCTAGTCAGCTCCAGTCCCCTTCCATTTTCCTCGCCTCACTACCAAAAGCTAGGGTTTACAGTTTCT
ACAATTTCAAAATTTTTTGAATCTGTAGTAATCGTATTTGAAGGTAATCGGAAAAAGCT
(5')ATGGACCCGATGAAGTTGAATCAACTG
AAGCAATTCGTTGAACAGTGCAAATCCAATCCTTCCATTCTCTCCGATCCTTCTCTTTCATTTTTCCGTGACTACATTGAGAATCTCGGT
GCTAAACTTCCTCCGGCTGCTTACGACACCGGCGATTACAAAGAGAAGTCCCATGCGGTGGATGCGAGTGATGATGAGATGGATGATGAT
GAGAATGATGCTAATATCAAAGAGACAGTTGAAGAAGAGGAGGAGCCTGAGATAATTGAATCTGATATTGAGCTTGATGAGAGTGACACT
GTGGAACCTGACAATGATGAGCCACAGAAGATGGGAGACCCTTCTGTGGAGGTGACTGAAGAAAGCCGTGATGCTTCTCAGGAGTCCAAA
GCTGAGGCCATGGAAGCAATTTCTGAAGGTAAGTTAGAAGATGCAATTGAGCATCTTACAAAGGCAGTTCTCCTCAATCCTAAATCAGCA
ATTATGTATGCTACTAGAGCTAGTGTTTATATCAAGATGAAGAAGCCAAACGCTGCCATACGAGATGCAACTGCAGCATTGGAGTTGAAT
CCAGATTCTGCTAAAGGTTACAAATCTCGTGGCATTGCCAGAGCCATGCTGGGACAGTGGGAGGCAGCTGCTAAGGATCTTCATGTGGCT
TCGAAGCTGGACTATGATGAGGAAATAAGTGCTGTGCTTAAGAAGGTTGAGCCCAATGCACATAGAATTGAAGAACACCGCAGGAAATAT
GATAGGTTGCGCAAAGAACGAGAAGATAGAAAGATTGAGCGTGAGAGACAACGAAGAAAGGCTGAAGCTCAGGCTGCTTATGAAAAGGCC
AAGAAGCAAGAAGAATCATCAAGTAGGAGAGCTGGTGGCATGCCTGGAGGCTTTCCAGGTGGCATGCCCGGAGGCTTTCCAGGGGGTATG
CCTGGGTCTGCACCTGGAGGAATGCCCGGAGGCATGCCTGGGGCTGCACCTGGAGGAATGCCCGGTAACATGGACTACAGCAAAATACTG
AATGACCCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGATGTGATGAAGAACCCAGCTAATTTGGCCAAG
CATCAAGGAAATCCTAAGATTGCTCCTATTATTGCAAAAATGATGGGCAAGTTTGCTGGAAATAATTGA(3')GAGCTTTTGGGATTTTG
TCCGTNAGAATTTCTAGAGTTTGATAGAGAACATGTTGTTTTACCGTAAGCTTGTTTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan