ESTScan Details for Unigene SGN-U315727

Score 
469
Direction 
Forward
Predicted Peptide Sequence 
MQSKDKKVLLQIKKDLGNPYHLASWDPNTDCCYWYVVKCDRKTNRINALTVFQANISGQIPAAVGDLPYLETLEFHHVTNLTGTIPPAIA
KLTNLKMLRLSFTNLTGPIPEFLXSAEEFDVARVELQSIYRNNPFFPLSASEFASDVLDRNKLTGTIPESFGRFKGPNIPDLYLSHNSLT
GHVPASLGDLNFSTLDFSRNKLEGDVSFLFGKNKTSQVIDLSRNLLEFDISKSEFAESLISLDLNHNRIFGSLPPGLKDVPLQFFNVSYN
RLCGQIPQGGTLQSFDIYSYLHNNAFVALPCRNVSRYGGRGFK
Predicted Coding Sequence 
ATGCAATCCAAAGACAAAAAAGTCCTTCTACAAATAAAGAAAGACTTAGGCAATCCTTACCATTTAGCTTCATGGGATCCAAACACAGAT
TGCTGTTACTGGTACGTCGTAAAATGTGACCGGAAAACCAACCGGATAAATGCTCTCACCGTCTTCCAAGCCAATATCTCCGGCCAAATT
CCGGCAGCCGTCGGAGACCTTCCATATCTCGAAACATTGGAATTTCATCATGTTACTAATCTCACCGGAACAATTCCACCTGCAATTGCG
AAGCTCACAAATCTCAAAATGTTAAGGCTCAGCTTCACTAACCTTACAGGTCCGATCCCTGAATTCCTTAXGTCAGCTGAAGAATTTGAC
GTTGCTCGAGTTGAATTACAATCAATTTACCGGAACAATCCCTTCTTCCCTCTCTCAGCTTCCGAATTTGCTAGCGATGTACTTGATCGT
AACAAACTCACCGGAACAATACCGGAATCGTTTGGGAGATTTAAAGGACCAAATATACCAGATCTCTACCTTTCACACAACAGCTTGACC
GGACATGTGCCGGCATCTTTAGGTGATTTGAATTTTTCCACGCTTGATTTCTCCAGGAATAAGCTTGAAGGAGATGTTTCGTTTTTGTTC
GGGAAGAATAAGACGAGTCAGGTAATTGATTTATCGAGGAATTTATTGGAGTTTGATATTTCGAAATCGGAGTTTGCTGAGAGCTTGATA
TCATTGGATTTGAATCATAATCGAATTTTTGGTAGCTTACCACCAGGATTGAAAGATGTACCATTGCAGTTTTTCAATGTGAGTTATAAT
AGACTTTGTGGACAGATTCCACAAGGTGGAACGTTGCAGAGCTTTGATATTTACTCTTATTTGCATAACAATGCCTTTGTGGCTCTCCCT
TGCCGAAATGTAAGTAGGTATGGAGGTCGAGGATTTAAATAA
Edits in Original Sequence 
TAAGTTATAATATAATATTGTTCATAAAAAAAGAAGAGAGAATATGAACTTGTCTCTTCTTCTTGTAGTTATTTTTCTTTGCTTTGCTTC
TCCTTCACTATCAGTAAG
(5')ATGCAATCCgAAAGACAAAAAAGTCCTTCTACAAATAAAGAAAGACTTAGGCAATCCTTACCATTTAG
CTTCATGGGATCCAAACACAGATTGCTGTTACTGGTACGTCGTAAAATGTGACCGGAAAACCAACCGGATAAATGCTCTCACCGTCTTCC
AAGCCAATATCTCCGGCCAAATTCCGGCAGCCGTCGGAGACCTTCCATATCTCGAAACATTGGAATTTCATCATGTTACTAATCTCACCG
GAACAATTCCACCTGCAATTGCGAAGCTCACAAATCTCAAAATGTTAAGGCTCAGCTTCACTAACCTTACAGGTCCGATCCCTGAATTCC
TTAXGTCAGCTGAAGAATTTGACGTTGCTCGAGTTGAATTACAATCAATTTACCGGAACAATCCCTTCTTCCCTCTCTCAGCTTCCGAAT
TTGCTAGCGATGTACTTaGATCGTAACAAACTCACCGGAACAATACCGGAATCGTTTGGGAGATTTAAAGGACCAAATATACCAGATCTC
TACCTTTCACACAACAGCTTGACCGGACATGTGCCGGCATCTTTAGGTGATTTGAATTTTTCCACGCTTGATTTCTCCAGGAATAAGCTT
GAAGGAGATGTTTCGTTTTTGTTCGGGAAGAATAAGACGAGTCAGGTAATTGATTTATCGAGGAATTTATTGGAGTTTGATATTTCGAAA
TCGGAGTTTGCTGAGAGCTTGATATCATTGGATTTGAATCATAATCGAATTTTTGGTAGCTTACCACCAGGATTGAAAGATGTACCATTG
CAGTTTTTCAATGTGAGTTATAATAGACTTTGTGGACAGATTCCACAAGGTGGAACGTTGCAGAGCTTTGATATTTACTCTTATTTGCAT
AACaAATGCCTTTGTGGCTCTCCCTTGCCGAAATGTAAGTAGGTATGGAGGTCGAGGATTTAAATAA(3')TCGAGAATTGTAGTAGAGG
CAACTAGCCTTCTCTAGTCGTTCCTAATCATATTTAGTGCTCTTTTCGCTTTTTATAATCCGTATGCGAGGATCTAATGAATATAGTCTC
TCTATCAATAAACTTATGAAATTTTACGAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan