ESTScan Details for Unigene SGN-U315741

Score 
548
Direction 
Forward
Predicted Peptide Sequence 
MPSHADLDRQIEQLMECKPLSEADVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYS
VETVTLLVALKVRYREESRFLGEIMKAGKSPKXYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRAL
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLTLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMA
AILEIGENMEQNFLQFDPAPRQIEPDTTRKTPDYXFVIPILALVCQQVCFRSGVLLVEDYSRDHSFVWSSTSLYASSSVELTKCPEW
Predicted Coding Sequence 
ATGCCGTCTCATGCAGATCTAGATCGGCAGATCGAACAATTGATGGAGTGCAAGCCGTTATCGGAAGCTGATGTGAAAACTCTGTGTGAT
CAAGCGAGGGCTATACTTGTTGAGGAATGGAATGTTCAACCGGTGAAATGTCCGGTGACTGTTTGTGGTGATATTCATGGACAGTTTTAC
GACCTGATTGAGCTGTTTCGGATTGGAGGAAATGCTCCTGATACTAATTATCTCTTCATGGGCGATTATGTTGACCGTGGATACTATTCA
GTGGAGACTGTCACACTTTTGGTTGCTCTGAAGGTTCGTTATAGAGAAGAATCACGATTCTTAGGGGAAATCATGAAAGCCGGCAAATCA
CCCAAGXTGTATGGTTTTTATGATGAATGCTTGAGGAAATATGGCAATGCAAATGTTTGGAAGTATTTCACTGATCTTTTTGATTATCTA
CCACTAACAGCACTGATAGAGAGTCAGATATTCTGTTTGCATGGAGGACTCTCACCTTCTCTGGATACACTGGATAATATCCGAGCGCTG
GACCGTATACAAGAGGTTCCACATGAAGGGCCAATGTGTGATCTCCTGTGGTCTGATCCAGATGATCGGTGTGGTTGGGGAATCTCACCT
CGAGGGGCTGGTTATACCTTTGGACAGGATATAGCATCTCAATTCAATCACACCAATGGTCTCACCCTGATTTCTAGAGCTCATCAGCTT
GTGATGGAGGGTTTCAATTGGTGTCAGGATAAGAATGTTGTGACAGTATTTAGTGCTCCAAACTATTGTTACCGGTGTGGTAATATGGCT
GCCATTCTAGAAATAGGCGAAAACATGGAGCAGAATTTCCTTCAGTTTGACCCAGCTCCTCGACAGATAGAGCCCGACACCACAAGGAAG
ACTCCAGATTACTTXTTTGTGATTCCAATACTTGCGCTTGTTTGCCAGCAGGTATGTTTCAGAAGTGGAGTTTTGCTGGTTGAGGATTAT
TCTCGAGACCATTCTTTTGTTTGGAGCTCGACTTCACTCTATGCCAGTAGCTCAGTAGAGTTGACGAAATGCCCCGAGTGG
Edits in Original Sequence 
AGAACTAGTCTCGAGTTGTTGCTGCATTTTTTCCAATAGAGAGAGAAAGGAGAGAGAGGAAAATGATGAAGAAGAACTTCAAAATTACCA
GATAATTTGGAGATTCAAACCCTAGCACTTTTAGCAATATTCAATCTCTTTGTATTTTTTTGAATTTTTTGGTGTTTAAATTTTATTTTT
TTGTTACGTATATTTCGTTTGATTGATTTCAGCTGAATATTCACCGTTTGATCTTCGATCGGTTTGATTCTCTGATCGGTCGGCGTGGAG
TTTTCAGATCGGAGATTGTGAGGAAAAGGAAAAATTCTGTTAAAGCACTAGAAAGTTTTAGAGGAATCTAGATAAAAAA
(5')ATGCCGT
CTCATGCAGATCTAGATCGGCAGATCGAACAATTGATGGAGTGCAAGCCGTTATCGGAAGCTGATGTGAAAACTCTGTGTGATCAAGCGA
GGGCTATACTTGTTGAGGAATGGAATGTTCAACCGGTGAAATGTCCGGTGACTGTTTGTGGTGATATTCATGGACAGTTTTACGACCTGA
TTGAGCTGTTTCGGATTGGAGGAAATGCTCCTGATACTAATTATCTCTTCATGGGCGATTATGTTGACCGTGGATACTATTCAGTGGAGA
CTGTCACACTTTTGGTTGCTCTGAAGGTTCGTTATAGAGAtAGAATCACGATTCTTAGGGGAAATCATGAAAGCCGGCAAATCACCCAAG
XTGTATGGTTTTTATGATGAATGCTTGAGGAAATATGGCAATGCAAATGTTTGGAAGTATTTCACTGATCTTTTTGATTATCTACCACTA
ACAGCACTGATAGAGAGTCAGATATTCTGTTTGCATGGAGGACTCTCACCTTCTCTGGATACACTGGATAATATCCGAGCGCTGGACCGT
ATACAAGAGGTTCCACATGAAGGGCCAATGTGTGATCTCCTGTGGTCTGATCCAGATGATCGGTGTGGTTGGGGAATCTCACCTCGAGGG
GCTGGTTATACCTTTGGACAGGATATAGCATCTCAATTCAATCACACCAATGGTCTCACCCTGATTTCTAGAGCTCATCAGCTTGTGATG
GAGGGTTTCAATTGGTGTCAGGATAAGAATGTTGTGACAGTATTTAGTGCTCCAAACTATTGTTACCGGTGTGGTAATATGGCTGCCATT
CTAGAAATAGGCGAAAACATGGAGCAGAATTTCCTTCAGTTTGACCCAGCTCCTCGACAGATAGAGCCCGACACCACAAGGAAGACTCCA
GATTACTTXTTTGTGATTCCAATACTTGCGCTTGTTTGCCAGCAGGTATGTTTCAGAAGTGGAGTTTTGCTGGTTGAGGATTATTCTCGA
GACCATTCTTTTGTTTGGAGCTCGACTTCACTCTATGCCAGTAGCTCAGTAGAGTTGACGAAATGCCCCGAGTGG(3')TTTTCATGTAT
ATTTTTCAAATCGAAGCAACACGGTACATTCTGTTCTGTAATTTGAAATCTACCGTAAAAAGCTGTTTTTTTCCCTCAATGTCCAATCAC
TGACTTGTTTCAACCAAATTTTCTTTTGCCTTCTAGTTTTTAAAAGAGAAAAAATGGTTGTAATAGGCATTTTTACCTTATCTTTAGTAC
TATAGGGGTTTCAAACTCTAGATATCTCTCGCTTTTGTCATTGTTCGTTGCTGCTATGGTATCATGATACAAAATTAAATAACGTAGTGT
AAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan