ESTScan Details for Unigene SGN-U315774

Score 
765
Direction 
Forward
Predicted Peptide Sequence 
MGGGKDDSDKGIFSNIAGGMSHLAGGHHGHPGQYPPQHGGYPPQQGYPPQGYPPQQGYPPQQGYPPQGYPPQGGYPPQQGYPPQGYPPAG
HHGAPQHHSGHGGMGVMLAGGAAAAAAAYGAHKLSHGHGGSHMGGHGMPFVGGASHYGGGKFKHGKGGKFKHGKHGKFKHGKGGMFGGKF
KKWK
Predicted Coding Sequence 
ATGGGAGGTGGTAAGGATGATTCTGATAAGGGAATCTTTAGCAATATAGCGGGAGGTATGAGTCATCTTGCTGGTGGTCATCACGGACAT
CCAGGACAGTATCCTCCACAGCACGGTGGTTACCCTCCGCAGCAAGGGTATCCTCCTCAAGGGTACCCTCCTCAACAAGGGTACCCTCCA
CAGCAAGGGTATCCACCGCAGGGTTATCCTCCGCAAGGAGGATATCCTCCACAACAAGGATATCCTCCACAAGGGTATCCTCCTGCAGGT
CATCATGGTGCTCCACAGCATCATTCAGGACATGGTGGCATGGGGGTAATGTTAGCTGGAGGTGCTGCAGCTGCAGCTGCTGCTTATGGC
GCTCATAAGCTGTCTCACGGACACGGTGGATCTCACATGGGAGGACATGGTATGCCATTTGTTGGAGGCGCCAGTCATTATGGAGGAGGC
AAGTTTAAGCATGGCAAGGGAGGGAAATTCAAACATGGAAAGCACGGCAAGTTTAAGCATGGCAAGGGAGGGATGTTCGGAGGTAAATTC
AAGAAGTGGAAGTAA
Edits in Original Sequence 
TAGGGCGATTGGCGGCCAATCGGCCGAATTGATTGTTAAACAAAACTTTCGTTCAACTTCTCAAGGGGAAAAATCTGTACTAGTGAAAT
(5')ATGGGAGGTGGTAAGGATGATTCTGATAAGGGAATCTTTAGCAATATAGCGGGAGGTATGAGTCATCTTGCTGGTGGTCATCACGGA
CATCCAGGACAGTATCCTCCACAGCACGGTGGTTACCCTCCGCAGCAAGGGTATCCTCCTCAAGGGTACCCTCCTCAACAAGGGTACCCT
CCACAGCAAGGGTATCCACCGCAGGGTTATCCTCCGCAAGGAGGATATCCTCCACAACAAGGATATCCTCCACAAGGGTATCCTCCTGCA
GGTCATCATGGTGCTCCACAGCATCATTCAGGACATGGTGGCATGGGGGTAATGTTAGCTGGAGGTGCTGCAGCTGCAGCTGCTGCTTAT
GGCGCTCATAAGCTGTCTCACGGACACGGTGGATCTCACATGGGAGGACATGGTATGCCATTTGTTGGAGGCGCCAGTCATTATGGAGGA
GGCAAGTTTAAGCATGGCAAGGGAGGGAAATTCAAACATGGAAAGCACGGCAAGTTTAAGCATGGCAAGGGAGGGATGTTCGGAGGTAAA
TTCAAGAAGTGGAAGTAA(3')ACTAGGTACAGTATCGAAGACTTCAGCTGGCTTTACAGTGTTCTAATGTTCGTCTCTTTAAATAAGAC
ATACTACATGTTATTATGGCCTATATGTGGCCTGTGAGATATTGTCTTGCTATGCATTTTCAATTACTAATTTGAGTGAGTTTCTGCAGT
CGAAAAGCTCCCATAGGGGCATAAACTTTCCTTATTTCTTCCTATCTTCTTCTGTATTCGCGCTCATTCGCTTCGTTTCCTAGCTTTTTT
GTACAGTATTGCAGTACTACTAACTCCATGGTTGAAAAAGTTGCAGACTTTTTTTTTCTAAAAAATTGTTATCAATTGTTTGTTTCTGTG
TGAATTTAATAAATTGTGAAGCCGAGTTGTTTGCGAAAAANAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan