ESTScan Details for Unigene SGN-U315898

Score 
624
Direction 
Forward
Predicted Peptide Sequence 
MAKINVMIAVVVLVVSVMSIEQATAARRLQQFGGFPMPTTPSTGGGFPSFPMPTTPSTGGGFPSFPMPTTPGFPTPSTGGGGFGGLPSFP
FPPFPNTPADATQTTTP
Predicted Coding Sequence 
ATGGCGAAGATAAATGTCATGATAGCCGTTGTCGTGCTTGTTGTATCAGTAATGTCAATTGAGCAAGCCACAGCAGCTCGACGTCTTCAG
CAATTTGGTGGTTTCCCTATGCCTACTACTCCATCAACTGGTGGTGGTTTCCCCTCATTTCCTATGCCTACGACTCCATCAACTGGTGGT
GGTTTCCCCTCATTTCCTATGCCTACTACTCCAGGTTTTCCTACTCCATCAACTGGTGGCGGCGGCTTTGGTGGGCTGCCTAGTTTTCCA
TTTCCCCCATTCCCCAACACTCCAGCTGATGCCACACAAACCACTACTCCTTGA
Edits in Original Sequence 
ATTTTTTTACAACAACAAAAA(5')ATGGCGAAGATAAATGTCATGATAGCCGTTGTCGTGCTTGTTGTATCAGTAATGTCAATTGAGCA
AGCCACAGCAGCTCGACGTCTTCAGCAATTTGGTGGTTTCCCTATGCCTACTACTCCATCAACTGGTGGTGGTTTCCCCTCATTTCCTAT
GCCTACGACTCCATCAACTGGTGGTGGTTTCCCCTCATTTCCTATGCCTACTACTCCAGGTTTTCCTACTCCATCAACTGGTGGCGGCGG
CTTTGGTGGGCTGCCTAGTTTTCCATTTCCCCCATTCCCCAACACTCCAGCTGATGCCACACAAACCACTACTCCTTGA(3')AATGTAA
CTTCATACACACGACTCTCAACTATCCATATCTTTCTGATCCCCCCTTATAATTAACTTCTGATTGATGTATTTCTATTGTTTAAATTAA
AATTGCTTACTGAAGCAATTGTTGCTTAATGTTTGTTGTTATTTATGTAACTAAGCTATGTACTGATTATTCGTTGTTTCATTCAATACT
ACTAGCTTCATTTATCATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan