ESTScan Details for Unigene SGN-U315962

Score 
436
Direction 
Forward
Predicted Peptide Sequence 
MVTTGKKSKRTHESINNRLALVMKSGKYTLGYKTVLKTLRTSKGKLILISNNCPPLRKSEIEYYAMLAKVGVHHFNGNNVDLGTACGKFH
RVSCLSIIDPGDSDIIKSLPGDQ
Predicted Coding Sequence 
ATGGTGACTACCGGGAAGAAATCGAAGAGGACTCATGAGAGCATTAACAACAGATTGGCTCTCGTAATGAAGAGTGGAAAGTACACTCTT
GGTTACAAGACTGTTCTCAAGACTCTCAGGACCTCAAAAGGGAAGTTGATATTGATATCAAACAACTGCCCACCTTTGAGGAAATCTGAG
ATTGAGTATTATGCTATGCTCGCTAAAGTTGGTGTTCACCATTTCAATGGAAACAATGTTGATCTTGGTACAGCATGTGGAAAGTTCCAC
CGTGTGTCATGCCTGAGCATCATTGACCCAGGTGATTCCGACATTATCAAGTCTCTGCCTGGAGATCAGTAA
Edits in Original Sequence 
GGCGGCCAATCGGCCGAATTGGTTCCCTGTTTTTCCCCTTCCCCCTTTCCCCTTAGTTTCACAGATCTTTGTGTAATCAAGA(5')ATGG
TGACTACCGGGAAGAAATCGAAGAGGACTCATGAGAGCATTAACAACAGATTGGCTCTCGTAATGAAGAGTGGAAAGTACACTCTTGGTT
ACAAGACTGTTCTCAAGACTCTCAGGACCTCAAAAGGGAAGTTGATATTGATATCAAACAACTGCCCACCTTTGAGGAAATCTGAGATTG
AGTATTATGCTATGCTCGCTAAAGTTGGTGTTCACCATTTCAATGGAAACAATGTTGATCTTGGTACAGCATGTGGAAAGTTCCACCGTG
TGTCATGCCTGAGCATCATTGACCCAGGTGATTCCGACATTATCAAGTCTCTGCCTGGAGATCAGTAA(3')GAGTTGATGATCTAGTAG
TCATTCTCTTTAAACAATTTAGAAAATGTTTTGCGGGGCTGCTCTAAACCATTTTACTGATGTTGAGAGAATCTGTAGTATCTTTTTGTT
CTTTGTGTTTTGGAGTTATACTGAGATTCTAGAGTATTTTGGTATTATCTAGTTTTGTTGGTTTTATCATTTCTCCATATGTTTGTTGAG
GCCAAATACATTATGATTTATTCATAGATCAATTTTCCTTGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan