ESTScan Details for Unigene SGN-U316056

Score 
800
Direction 
Reverse
Predicted Peptide Sequence 
MTAGTILSSXTYKQCLFIQLMQQMGQTTGFNLELXKSSAGGISLKSSPSSGSSEVSGPKIPSELRVNPLSGWNLSISARAMASAWAILCL
NVWAISSAFSKTSFGLRIMSPGVGSSFFEKGSLDYNSPGGGGYNSAGGGGYGSSSGYNYGGGEGRNFAGSGGYQTNNYGGGFSSGHSSAG
GYGSYGGGSSSYGNNSSPVEGGNYGSSTPNINYSGQGSSFSGGYGGGNSGNDFGGAPSNNNNSFANTGFGGRSEASYNGSQEQVSADQGI
QSVNEHLGEETSEGNYRDDDDEPKDTPTPGAEVIFGIKKMSRTCLSHA
Predicted Coding Sequence 
ATGACTGCGGGTACAATTCTTAGTTCCTAAACCTACAAACAATGTTTATTTATACAACTTATGCAACAAATGGGTCAAACGACGGGTTTT
AATTTAGAACTCATXAAATCATCAGCTGGTGGAATCTCACTCAAGTCCAGTCCATCCTCAGGTAGTTCAGAGGTCAGCGGACCTAAAATC
CCGTCAGAGTTGAGGGTCAATCCACTCTCAGGCTGGAATCTCAGCATATCTGCACGGGCCATGGCTTCAGCTTGGGCAATTCTCTGCCTG
AATGTCTGGGCCATCTCTTCAGCCTTCTCAAAGACAAGCTTTGGATTGCGAATCATGTCACCAGGTGTAGGCTCTAGCTTCTTTGAGAAA
GGCTCACTCGACTACAATTCTCCTGGAGGAGGTGGCTACAATTCTGCTGGAGGAGGTGGCTACGGTAGCAGTAGTGGCTATAACTATGGC
GGGGGGGAAGGCAGAAATTTTGCAGGTTCTGGAGGTTACCAAACCAACAATTACGGTGGTGGATTTTCTAGTGGTCACAGTTCTGCTGGA
GGCTACGGTAGCTATGGAGGTGGTAGTAGCAGCTATGGGAACAACAGTTCCCCTGTTGAGGGTGGCAACTACGGAAGCAGCACTCCAAAC
ATCAATTATTCTGGTCAAGGCAGTAGTTTCTCAGGTGGTTATGGTGGTGGCAACAGTGGGAATGACTTTGGTGGAGCTCCTAGTAACAAT
AATAATAGCTTCGCTAACACGGGATTTGGTGGGAGATCTGAAGCATCATATAATGGAAGCCAAGAACAGGTTAGTGCAGATCAGGGAATT
CAATCTGTAAATGAACATCTCGGAGAGGAAACATCAGAAGGGAACTACAGGGATGACGATGACGAACCAAAGGATACGCCAACACCAGGA
GCTGAAGTGATTTTTGGTATCAAGAAAATGTCTAGGACATGTTTGAGTCATGCGTGA
Edits in Original Sequence 
TTTTTTTTTTTCGTAAAAAAAACCAAGNCATGCTGTGATAGTTACTGATGCTAGCGCTGCTTCTCTTAGAACAAAACTGCAAGTCAAGTA
GTTGAGGATCATATGATAAAATACAATAGA
(5')ATGACTGCGGGTACAATTCTTAGTTCCTAAACCTACAAACAATGTTTATTTATACA
ACTTATGCAACAAATGGGTCAAACGACGGGTTTTAATTTAGAACTCATXAAATCATCAGCTGGTGGAATCTCACTCAAGTCCAGTCCATC
CTCAGGTAGTTCAGAGGTCAGCGGACCTAAAATCCCGTCAGAGTTGAGGGTCAATCCACTCTCAGGCTGGAATCTCAGCATATCTGCACG
GGCCATGGCTTCAGCTTGGGCAATTCTCTGCCTGAATGTCTGGGCCATCTCTTCAGCCTTCTCAAAGACAAGCTTTGGATTGCGAATCAT
GTCACCAGGTGTAGGCTCTAGCTTCTTTGtAGAAAGGCTCACTCGACTACAATTCTCCTGGAGGAGGTGGCTACAATTCTGCTGGAGGAG
GTGGCTACGGTAGCAGTAGTGGCTATAACTATGGCGGGGGGGAAGGCAGAAATTTTGCAGGTTCTGGAGGTTACCAAACCAACAATTACG
GTGGTGGATTTTCTAGTGGTCACAGTTCTGCTGGAGGCTACGGTAGCTATGGAGGTGGTAGTAGCAGCTATGGGAACAACAGTTCCCCTG
TTGAGGGTGGCAACTACGGAAGCAGCACTCCAAACATCAATTATTCTGGTCAAGGCAGTAGTTTCTCAGGTGGTTATGGTGGTGGCAACA
GTGGGAATGACTTTGGTGGAGCTCCTAGTAACAATAATAATAGCTTCGCTAACACGGGATTTGGTGGGAGATCTGAAGCATCATATAATG
GAAGCCAAGAACAGGTTAGTGCAGATCAGGGAATTCAATCTGTAAATGAACATCTCGGAGAGGAAACATCAGAAGGGAACTACAGGGATG
ACGATGACGAACCAAAGGAtTACGCCAACACCAGGAGCTGAAGTGATTTTTGGTATCAAGAAAATGTCTAGGACATGTTTGAGTCATGCG
TGA(3')ATAAGATAAATAATTCTGACTATTGATGTTTCCTTTTCAAGTATCAATAGTACTCAGCTTATTTAATTTGAATTGGTCAATTC
GTACTGGCAATATTTGCAACGTGCATTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan