ESTScan Details for Unigene SGN-U316087

Score 
491
Direction 
Forward
Predicted Peptide Sequence 
RASTHSGFPEERGCPIXIFRKLYSYKFCIHNHQSQEWRIDNDSRGRFLSYNIYLKTSSWVQFVAACEMNVKILPIQTAQYIGTAYAFDXF
VQNFLHMYASLFHRGEQHAIASSTQGTTSLSSSASLDNSLSDMYRSPPRPLPYDADPRYFRLQRDGLVSRREKGSSHSHEETEPLRRSDI
DDDSESLGMGNKWKESVCEEGSKEYNSKSLKFSTAKTTTEFTQICYSSEDEDVCPTCLEEYTEENPKIMTKCSHHFHLGCIYEWMERSDN
CPVCGKXDAIQRVAMIFALKKLXVVDXNQKEIRATTSKPEKLINVKVIVNICAAKCVTIHQ
Predicted Coding Sequence 
AGGGCATCAACTCATTCAGGGTTTCCTGAAGAGAGAGGGTGCCCAATTGXCATTTTCCGTAAGTTATATTCTTACAAGTTTTGCATCCAT
AACCATCAATCACAAGAATGGAGGATTGACAATGATAGCCGTGGAAGGTTTTTGAGTTACAACATTTATTTGAAGACATCATCATGGGTG
CAGTTTGTTGCTGCTTGCGAGATGAATGTGAAGATTTTGCCAATCCAAACAGCTCAATATATAGGAACTGCTTATGCCTTCGATGXTTTT
GTTCAAAACTTCTTGCATATGTATGCATCATTGTTTCATAGAGGAGAACAACATGCCATTGCTTCATCCACTCAAGGTACAACATCTTTG
AGCTCCTCAGCATCCCTTGATAACTCACTATCTGATATGTACCGCTCTCCTCCAAGACCACTTCCTTACGATGCTGATCCAAGATACTTC
CGCTTGCAACGTGATGGGCTAGTCTCAAGAAGGGAGAAAGGCTCAAGTCATTCACATGAGGAAACTGAACCACTACGAAGAAGTGATATT
GATGATGATTCTGAATCTTTGGGTATGGGCAATAAATGGAAGGAGTCTGTATGTGAAGAAGGATCAAAAGAATATAATTCCAAGTCATTG
AAATTCTCAACAGCTAAAACAACTACTGAGTTTACTCAAATTTGTTATTCTTCAGAAGATGAAGATGTCTGCCCGACATGTCTTGAAGAA
TATACTGAAGAAAACCCAAAAATAATGACAAAATGCTCTCACCACTTCCACTTGGGTTGCATATATGAGTGGATGGAGAGAAGTGACAAC
TGTCCAGTATGCGGCAAGGXTGATGCTATTCAACGAGTCGCCATGATCTTTGCTCTTAAAAAGCTTXTAGTCGTGGATGAXAACCAGAAG
GAGATAAGGGCAACAACTAGTAAACCAGAAAAGCTAATCAACGTXAAAGTCATTGTGAATATCTGTGCAGCTAAATGTGTGACCATACAT
CAGTAA
Edits in Original Sequence 
CATTGTGTAGATAGAAAAAATAAAAAAGAAACCCTTTGACCTCTGAAATTATCTATTTTTATCTTTCTCTCTATTATCCCCGCAATCTCC
GCTATTTTCAGGTGATACACAACAGTTTTTGAAATTTTTTCTGAAGGTCTTGGTCATGA
(5')AGGGCATCAACTCATTCAGGGTTTCCT
GAAGAGAGAGGGTGCCCAATTGXCATTTTCCGTAAGTTATATTCTTACAAGTTTTGCATCCATAACCATCtAATCACAAGAATGGAGGAT
TGACAATGATAGCCGTGGAAGGTTTTTGAGTTACgAACATTTATTTGAAGACATCATCATGGGTGCAGTTTGTTGCTGCTTGCGAGATGA
ATGTGAAGATTTTGCCAATCCAAACAGCTCAATATATAGGAACTGCTTATGCCTTCGATGXTTTTGTTCAAAACTTCTTGCATATGTATG
CATCATTGTTTCATAGAGGAGAACAACATGCCATTGCTTCATCCACTCAAGGTACAACATCTTTGAGCTCCTCAGCATCCCTTGATAACT
CACTATCTGATATGTACCGCTCTCCTCCAAGACCACTTCCTTACGATGCTGATCCAAGATACTTCCGCTTGCAACGTGATGGGCTAGTCT
CAAGAAGGGAGAAAGGCTCAAGTCATTCACATGAGGAAACTGAACCACTACGAAGAAGTGATATTGATGATGATTCTGAATCTTTGGGTA
TGGGCAATAAATGGAAGGAGTCTGTATGTGAAGAAGGATCAAAAGAATATAATTCCAAGTCATTGAAATTCTCAACAGCTAAAACAACTA
CTGAGTTTACTCAAATTTGTTATTCTTCAGAAGATGAAGATGTCTGCCCGACATGTCTTGAAGAATATACTGAAGAAAACCCAAAAATAA
TGACAAAATGCTCTCACCACTTCCACTTGGGTTGCATATATGAGTGGATGGAGAGAAGTGACAACTGTCCAGTATGCGGCAAGGXTGATG
CTATTCAACGAGTCGCCATGATCTTTGCTCTTAAAAAGCTTXTAGTCGTGGATGAXAACCAGAAGGAGATAAGGGCAACAACTAGTAAAC
CAGAAAAGCTAATCAACGTXAAAGTCATTGTGAATATCTGTGCAGCTAAATGTGTGACCATACATCAGTAA(3')AAATGAAATTACTGT
TCTCTCTGTTTGGAACTTTCGAGTTCATATTGATCATTTGATGCAACAGAAAACAGTTTCAAAGTACATCATGTAATCTTGTTTTGATTT
GATGAGTGATTTCTCCCAGTGTATAGCACATTGTTCCTACTTTCACAAGTTGAATGTTGGCACATTTGTCTGCCAAAATCACTGGATCTG
ATACTATTTTATATCTGTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAANNTTTTTGGGGGGGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan