ESTScan Details for Unigene SGN-U316105

Score 
1497
Direction 
Forward
Predicted Peptide Sequence 
KTLNPSNTPQRHFQLRSFFNGVRRFQKSQFEARVVTLSSNLLVLRGGSVSTQFLLSETKNGNDTSSLSNPWWRSMATFTRTKPHVNVGTI
GHVDHGKTTLTAAITKVLAEEGKAKAIAFDEIDKAPEEKKRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSA
PDGPMPQTKEHILLARQVGVPSLVCFLNKVDAVDDPELLELVEMELRELLSFYKFPGDEIPIIRGSALSALQGTNEEIGKKAILKLMDAV
DEYIPDPVRQLDKPFLMPVEDVFSIQGRGTVATGRIEQGTIKVGEDVEILGLMQGTLKSTVTGVEMFKKILDNGQAGDNVGLLLRGLKRE
DITRGMVIAKPGSVKTSKKFEAEIYVLTKDEGGRHTAFFSNYRPQFYMRTADITGKVELPENVKMVMPGDNVTATFELISPVPLETGQRF
ALREGGRTVGAGVVSKXTELRVLKMQASVSAGFVSRGAEQMKILLLLAEIQDT
Predicted Coding Sequence 
AAAACXCTAAACCCTTCAAATACCCCTCAACGCCATTTCCAGCTTCGTAGCTTCTTCAATGGCGTCCGTCGTTTTCAGAAATCCCAATTC
GAAGCGCGTGTTGTCACTCTCTCCTCAAATCTACTCGTGTTGAGAGGAGGATCAGTTTCCACTCAGTTTTTGCTCTCCGAAACGAAAAAT
GGAAATGATACTTCCAGTCTTTCTAATCCATGGTGGAGATCTATGGCCACCTTCACTCGAACAAAACCTCATGTAAATGTGGGAACTATA
GGACACGTTGATCATGGAAAGACTACTCTTACTGCTGCAATTACAAAGGTTCTAGCAGAAGAAGGAAAGGCCAAGGCAATTGCATTTGAT
GAAATTGACAAAGCCCCTGAAGAGAAGAAGAGAGGAATTACTATTGCTACAGCCCACGTGGAGTATGAGACAGCTAAAAGACATTATGCT
CATGTTGACTGCCCAGGACACGCGGATTACGTTAAAAATATGATTACCGGAGCTGCCCAAATGGATGGTGGTATTCTAGTTGTATCTGCT
CCAGATGGACCTATGCCGCAAACAAAGGAGCATATTCTTCTTGCCCGCCAGGTCGGTGTGCCCTCTCTTGTCTGCTTTTTAAACAAAGTT
GATGCTGTTGACGATCCTGAGCTGCTGGAACTTGTTGAAATGGAGCTTCGAGAACTTCTTAGTTTCTACAAGTTTCCTGGGGATGAAATT
CCTATCATCCGTGGTTCAGCTCTTTCTGCTTTACAGGGAACTAATGAAGAAATTGGAAAGAAAGCTATTTTAAAGTTGATGGATGCTGTA
GATGAATACATTCCAGATCCAGTGCGTCAGCTTGATAAACCATTCTTAATGCCAGTAGAAGATGTATTTTCAATTCAGGGACGTGGAACT
GTTGCTACTGGCCGTATTGAACAGGGAACAATAAAAGTTGGAGAGGATGTGGAGATTTTAGGGCTGATGCAGGGAACCTTAAAATCTACA
GTGACTGGTGTCGAAATGTTCAAGAAGATCTTGGATAATGGTCAAGCTGGTGATAATGTCGGGCTTCTTCTACGTGGCTTGAAACGAGAA
GATATTACACGAGGAATGGTAATTGCAAAGCCTGGTAGTGTGAAAACGTCCAAGAAATTTGAGGCAGAAATATACGTACTAACTAAGGAT
GAAGGTGGTCGGCACACTGCTTTTTTCTCAAACTATAGGCCTCAGTTCTACATGAGAACTGCTGACATTACCGGTAAAGTGGAGTTGCCT
GAAAATGTCAAGATGGTTATGCCCGGTGATAATGTTACAGCTACCTTTGAGCTGATATCTCCAGTTCCTCTTGAAACAGGACAAAGATTT
GCCCTGAGAGAGGGTGGCAGAACGGTTGGTGCTGGGGTTGTTTCTAAAGXTACTGAGCTGAGGGTTCTGAAAATGCAAGCTTCAGTTTCA
GCTGGTTTTGTCTCAAGAGGAGCTGAACAAATGAAAATTCTATTGCTGCTTGCGGAAATACAAGACACGTGA
Edits in Original Sequence 
(5')AAAACXCTAAACCCTTCAAATACCCCTCAACGCCATTTCCAGCTTCGTAGCTTCTTCAATGGCGTCCGTCGTTTTCAGAAATCCCA
ATTCGAAGCGCGTGTTGTCACTCTCTCCTCAAATCTACTCGTGTTGtAGAGGAGGATCAGTTTCCACTCAGTTTTTGCTCTCCGAAACGA
AAAATGGAAATGATACTTCCAGTCTTTCTAATCCATGGTGGAGATCTATGGCCACCTTCACTCGAACAAAACCTCATGTAAATGTGGGAA
CTATAGGACACGTTGATCATGGAAAGACTACTCTTACTGCTGCAATTACAAAGGTTCTAGCAGAAGAAGGAAAGGCCAAGGCAATTGCAT
TTGATGAAATTGACAAAGCCCCTGAAGAGAAGAAGAGAGGAATTACTATTGCTACAGCCCACGTGGAGTATGAGACAGCTAAAAGACATT
ATGCTCATGTTGACTGCCCAGGACACGCGGATTACGTTAAAAATATGATTACCGGAGCTGCCCAAATGGATGGTGGTATTCTAGTTGTAT
CTGCTCCAGATGGACCTATGCCGCAAACAAAGGAGCATATTCTTCTTGCCCGCCAGGTCGGTGTGCCCTCTCTTGTCTGCTTTTTAAACA
AAGTTGATGCTGTTGACGATCCTGAGCTGCTGGAACTTGTTGAAATGGAGCTTCGAGAACTTCTTAGTTTCTACAAGTTTCCTGGGGATG
AAATTCCTATCATCCGTGGTTCAGCTCTTTCTGCTTTACAGGGAACTAATGAAGAAATTGGAAAGAAAGCTATTTTAAAGTTGATGGATG
CTGTAGATGAATACATTCCAGATCCAGTGCGTCAGCTTGATAAACCATTCTTAATGCCAGTAGAAGATGTATTTTCAATTCAGGGACGTG
GAACTGTTGCTACTGGCCGTATTGAACAGGGAACAATAAAAGTTGGAGAGGATGTGGAGATTTTAGGGCTGATGCAGGGAACCTTAAAAT
CTACAGTGACTGGTGTCGAAATGTTCAAGAAGATCTTGGATAATGGTCAAGCTGGTGATAATGTCGGGCTTCTTCTACGTGGCTTGAAAC
GAGAAGATATTACACGAGGAATGGTAATTGCAAAGCCTGGTAGTGTGAAAACGTCCAAGAAATTTGAGGCAGAAATATACGTACTAACTA
AGGATGAAGGTGGTCGGCACACTGCTTTTTTCTCAAACTATAGGCCTCAGTTCTACATGAGAACTGCTGACATTACCGGTAAAGTGGAGT
TGCCTGAAAATGTCAAGATGGTTATGCCCGGTGATAATGTTACAGCTACCTTTGAGCTGATATCTCCAGTTCCTCTTGAAACAGGACAAA
GATTTGCCCTGAGAGAGGGTGGCAGAACGGTTGGTGCTGGGGTTGTTTCTAAAGXTACTGAGCTGAGGGTTCTGAAAATGCAAGCTTCAG
TTTCAGtCTGGTTTTGTCTCAAGAGGAGCTGAACAAATGAAAATTCTATTGCTGCTTGCGGAAATACAAGACACGTGA(3')TGGTTGCT
AATTTAATCATCATTTGACATTTTTTTATATTGCAATGCCAAGAGATGTGTCGTCGTGAAATTGGATATATTGGAGAAAATAGTCCACTC
TGTAGCATCTTATAGTTCATAAGCAGTCATTACTTTAAATAATGAACTTTTTGGTGTATGAACTATGGTCTTTTTTTCTCTAGCATTCAT
GAGAAACTCCATGGTAGATGCTACGTTATCATATGTACACAATAAATCCTACCATCATTCCGAGCCGTTTGCTTGCAAAAAAAAAAAAAG
AAAGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan