ESTScan Details for Unigene SGN-U316307

Score 
549
Direction 
Forward
Predicted Peptide Sequence 
ILNTLLNFDFWRAFGGSSEIGEDDQTSAFNDLLEHNNKDDCWLLISGKVYDVTSFLDDHPGGDEVLLTATGKDATDDFEDVGHSDDAREM
LKKYFIGEIDSSTIPAERKHTPPPSATPSAGGXGFWKLMEAIAILVTLVDIGCSPCLPFLLPERIDQPVVMFQAVTGYPCSMSFHMLCFP
IQVMSICYLCWMSFTGIMRY
Predicted Coding Sequence 
XGCATACTAAACACGTTACTCAACTTTGACTTCTGGCGTGCGTTCGGCGGAAGTTCAGAGATCGGTGAAGATGACCAAACTTCTGCTTTT
AACGACTTGTTGGAGCACAACAACAAAGATGATTGCTGGCTTCTCATCTCTGGAAAGGTTTATGATGTAACCTCTTTTTTGGATGATCAT
CCTGGAGGTGATGAAGTGTTGCTAACTGCAACAGGCAAGGATGCGACAGATGATTTTGAAGATGTCGGTCACAGTGATGATGCAAGAGAG
ATGTTGAAGAAATACTTCATTGGTGAAATTGACAGTTCCACCATTCCTGCAGAACGCAAACATACCCCGCCTCCCTCAGCAACACCATCA
GCTGGAGGAXCAGGGTTCTGGAAACTCATGGAAGCTATTGCAATTCTTGTTACCCTTGTTGATATTGGTTGCAGCCCTTGCCTTCCGTTC
CTTTTACCAGAAAGAATAGATCAGCCAGTTGTCATGTTTCAAGCTGTGACTGGATACCCTTGCAGCATGTCATTTCATATGTTGTGCTTT
CCTATTCAGGTTATGTCTATTTGCTACCTTTGTTGGATGTCCTTTACTGGTATAATGAGATATTAA
Edits in Original Sequence 
(5')XGCATACTAAACACGTTACTCAACTTTGACTTCTGGCGTGCGTTCGGCGGAAGTTCAGAGATCGGTGAAGATGACCAAACTTCaTG
CTTTTAACGACTTGTTGGAGCACAACAACAAAGATGATTGCTGGCTTCTCATCTCTGGAAAGGTTTATGATGTAACCTCTTTTTTGGATG
ATCATCCTGGAGGTGATGAAGTGTTGCTAACTGCAACAGGCAAGGATGCGACAGATGATTTTGAAGATGTCGGTCACAGTGATGATGCAA
GAGAGATGTTGAAGAAATACTTCATTGGTGAAATTGACAGTTCCACCATTCCTGCAGAACGCAAACATACCCCGCCTCCCTCAGCAACAC
CATCAGCTGGAGGAXCAGGGTTCTGGAAACTCATGGAAGCTATTGCAATTCTTGTTACCCTTGTTGATATTGGTTGCAGCCCTTGCCTTC
CGTTCCTTTTACCAGAAAGAATAGATCAGCCAGTTGTCATGTTTCAAGCTGTGACTGGATACCCTTGCAGCATGTCATTTCATATGTTGT
GCTTTCCTATTCAGGTTATGTCTATTTGCTACCTTTGTTGGATGTCCTTTACTGGTATAATGAGATATTAA(3')GATGTTAGGTCTGTG
TTGGTAATGTTGTCTTTTAGAATAAAAGTTATATGGTAAAAAACAAATGGTGTACTATGCAATTTGGTTCTTCCATGATTGCCATCATTT
GTCTATTTTCTATTACGTAACAACTTTTACGTAATAGTTCACTCAGGTCACACTATTCTTGTATCCATGGTGTGATATTGTCCGTTGGAA
GATAAATTCACATGGTCCACCCCTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan