ESTScan Details for Unigene SGN-U316310

Score 
625
Direction 
Forward
Predicted Peptide Sequence 
MALVPSPDFAAPXIPSNTAPRILAMAPKKKVNKFDDNWKKQWFGAGLFYEGSEQVEVDVFKKLEKRKVLSTVEKAGLLSKAEELGFTLSS
IEKLGLFSKAEELGLLSLLEKSASFSPAALASAALPILVAAILTIVFIPDDTVGLVAAQAVLAGALGLTAVGLFVGSVVLDGLQEAD
Predicted Coding Sequence 
ATGGCTTTAGTTCCAAGCCCCGATTTCGCCGCCCCTXTAATTCCCTCCAATACCGCTCCGCGAATATTGGCCATGGCTCCTAAAAAGAAG
GTGAACAAGTTTGATGACAATTGGAAAAAGCAATGGTTTGGAGCGGGACTATTCTACGAGGGCAGCGAACAAGTGGAAGTTGATGTGTTC
AAAAAATTGGAGAAGCGAAAAGTTTTGAGCACTGTGGAGAAAGCTGGCCTTCTATCAAAGGCCGAAGAACTAGGATTTACACTCTCATCC
ATAGAAAAATTAGGGCTATTTTCAAAGGCCGAAGAACTCGGGCTGCTCAGTTTGCTGGAGAAGTCAGCTAGTTTCTCTCCTGCTGCTTTG
GCATCGGCAGCTCTTCCAATTCTAGTGGCAGCTATTTTAACAATCGTTTTCATCCCCGATGATACCGTGGGTCTTGTGGCGGCCCAGGCT
GTTTTGGCTGGAGCCCTCGGGTTGACTGCAGTCGGGTTGTTTGTTGGGTCAGTGGTTTTGGATGGGTTGCAGGAGGCTGATTGA
Edits in Original Sequence 
GCACCAGATTTGTACAGAGAAGAAAGGGAATATGTGAAGCAACAATCGAGAGAAGGTGAAACTCTTGTTCAATGGCGGCTGCAACAACTT
CTTACCTGAGTAACTTGGAGC
(5')ATGGCTTTAGTTCCAAGCCCCGATTTCGCCGCCCCTXTAATTCCCTCCAATACCGCTCCGCGAAT
ATTGGCCATGGCTCCTAAAAAGAAGGTGAACAAGTTTGATGACAATTGGAAAAAGCAATGGTTTGGAGCGGGACTATTCTACGAGGGCAG
CGAACAAGTGGAAGTTGATGTGTTCAAAAAATTGGAGAAGCGAAAAGTTTTGAGCACTGTGGAGAAAGCTGGCCTTCTATCAAAGGCCGA
AGAACTAGGATTTACACTCTCATCCATAGAAAAATTAGGGCTATTTTCAAAGGCCGAAGAACTCGGGCTGCTCAGTTTGCTGGAGAAGTC
AGCTAGTTTCTCTCCTGCTGCTTTGGCATCGGCAGCTCTTCCAATTCTAGTGGCAGCTATTTTAACAATCGTTTTCATCCCCGATGATAC
CGTGGGTCTTGTGGCGGCCCAGGCTGTTTTGGCTGGAGCCCTCGGGTTGACTGCAGTCGGGTTGTTTGTTGGGTCAGTGGTTTTGGATGG
GTTGCAGGAGGCTGATTGA(3')TTGACCATCGGTTTCATCCAACCTCACCTGAAAAATATGTAATAAAGGGATAGTTTTGTAGTTGTCA
GTGAGATTTATATGGTCAATCTCAATTTATTAGTGTAATTATTGTTGTTGTACACACTCAACAATTCCTAATCTTTATGGTCATGAATTC
ATTTTATGTAAGAAAAAAAGTATAGACAAATTAATTTTTGAAGATTGTGTAGTAAATTTCTCAATTTACAAAGAAATAATTTTGGCCTGC
TAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan