ESTScan Details for Unigene SGN-U316408

Score 
1650
Direction 
Forward
Predicted Peptide Sequence 
MALSACADVISFLNFRSSATDDTDTQSVAAKLSSSGLLRSQALIGGKWVDAYDGKTIKVHNPATGEVITDVPCMGGRETNDAISSAYDAF
SSWSKLTAAERSRYLRKWYDLIMAHKEELGQLMTLEQGKPLKEAIGEVSYGAGFIEFSAEEGKRIYGDIIPSPLADRRLFVLKQPVGVVG
AITPWNFPLAMITRKVGPALACGCTVVIKPSELTPLTALAAAELSIQAGIPPGVVNVVMGNAPDIGDALLASPQVRKITFTGSTKVGKKL
MEGAAATVKKVSLELGGNAPCIIFDDADLEVALKGALATKFRNTGQTCVCANRILVQEGIYDKFANAFAKAVQNMKVGDGFTEGVEQGPL
INEAAVQKVEYFVDEATSKGAKVLVGGKRHSLGMTFYEPTVVTGVNSEMLLAKEEVFGPVAPLLKFKTDEEAIQMANDTNAGLAAYIFST
NIKRAWRVTEALEYGIVGVNEGLVSTEVAPFGGVKQSGLGREGSKYGMDEYLEMKYVCLGSMS
Predicted Coding Sequence 
ATGGCTCTTTCTGCTTGTGCXGATGTTATATCGTTCCTCAATTTCAGGTCCAGTGCGACTGATGACACAGACACACAAAGTGTTGCTGCT
AAGCTGAGCAGCTCTGGATTGTTGCGGAGTCAGGCTCTTATTGGAGGGAAATGGGTTGATGCATATGATGGGAAGACTATAAAGGTCCAC
AATCCTGCAACAGGGGAGGTAATAACAGATGTGCCATGCATGGGAGGGAGGGAGACGAACGATGCAATTTCTTCTGCCTATGATGCATTT
AGTTCATGGAGCAAACTTACTGCCGCTGAAAGGAGCAGATATTTAAGGAAGTGGTACGATTTGATAATGGCCCATAAAGAAGAACTTGGA
CAGCTTATGACACTAGAGCAAGGGAAACCTCTAAAAGAGGCTATTGGTGAAGTTAGTTATGGGGCTGGTTTTATTGAGTTCTCCGCTGAG
GAGGGTAAACGTATATATGGTGACATCATTCCATCACCATTAGCAGATAGGCGGTTATTTGTTTTAAAGCAACCAGTTGGTGTTGTTGGT
GCAATTACCCCATGGAATTTTCCCTTGGCTATGATTACCCGAAAGGTTGGCCCTGCTCTTGCTTGTGGTTGCACAGTGGTGATTAAACCG
TCTGAACTCACACCCTTGACTGCTTTAGCAGCAGCTGAACTCTCCATTCAAGCTGGAATACCACCGGGCGTAGTGAATGTTGTTATGGGA
AATGCACCTGATATTGGAGACGCACTGCTTGCAAGCCCACAGGTAAGAAAAATTACATTCACAGGTTCAACCAAGGTTGGGAAAAAATTG
ATGGAAGGTGCTGCTGCCACCGTTAAAAAGGTGTCTCTTGAGCTAGGCGGTAATGCACCTTGCATCATCTTTGATGACGCAGATCTTGAA
GTAGCTTTAAAAGGAGCTCTCGCAACAAAGTTCCGTAACACCGGACAAACATGTGTATGTGCGAACAGAATACTTGTGCAAGAAGGGATA
TATGATAAATTCGCAAATGCTTTTGCTAAAGCTGTCCAAAACATGAAAGTTGGAGATGGTTTCACTGAAGGTGTAGAGCAAGGCCCTCTA
ATCAATGAAGCAGCAGTACAGAAGGTTGAATATTTTGTGGATGAAGCTACTTCAAAGGGAGCCAAAGTCCTTGTTGGTGGGAAGAGACAC
AGCCTTGGCATGACTTTCTACGAGCCTACAGTTGTTACTGGAGTTAACAGTGAGATGCTCTTGGCGAAAGAGGAAGTATTTGGGCCAGTC
GCCCCTCTTTTGAAGTTCAAAACAGACGAAGAAGCAATCCAAATGGCTAACGACACTAATGCTGGTTTAGCTGCTTATATATTCTCAACA
AACATCAAAAGAGCTTGGCGTGTTACTGAAGCTCTCGAATATGGAATTGTCGGAGTTAATGAAGGACTAGTTTCAACCGAGGTAGCTCCA
TTTGGGGGTGTGAAACAATCAGGTCTTGGCCGCGAAGGTTCTAAATACGGGATGGATGAATATTTAGAGATGAAATATGTGTGCTTGGGA
AGTATGAGCTAA
Edits in Original Sequence 
GGATATATAGTTTGCGTTGACTACTATTGAGGTAGTAGGTAGCATCTATTATCTTTTAGGGTTCCATCGCTCACGCACACTCTCCGGTAG
ATCTCCCAATTCTCCGACGGAAAAGTTTATTCATTTGGATGCTTGAAGTTGGAATTCGGGTGCTCTGATGCAAATGATTCGTGTGCGTAC
CAGA
(5')ATGGCTCTTTCTGCTTGTGCXGATGTTATATCGTTCCTCAATTTCAGGTCCAGTGCGACTGATGACgACAGACACACAAAGT
GTTGCTGCTAAGCTGAGCAGCTCTGGATTGTTGCGGAGTCAGGCTCTTATTGGAGGGAAATGGGTTGATGCATATGATGGGAAGACTATA
AAGGTCCACAATCCTGCAACAGGGGAGGTAATAACAGATGTGCCATGCATGGGAGGGAGGGAGACGAACGATGCAATTTCTTCTGCCTAT
GATGCATTTAGTTCATGGAGCAAACTTACTGCCGCTGAAAGGAGCAGATATTTAAGGAAGTGGTACGATTTGATAATGGCCCATAAAGAA
GAACTTGGACAGCTTATGACACTAGAGCAAGGGAAACCTCTAAAAGAGGCTATTGGTGAAGTTAGTTATGGGGCTGGTTTTATTGAGTTC
TCCGCTGAGGAGGGTAAACGTATATATGGTGACATCATTCCATCACCATTAGCAGATAGGCGGTTATTTGTTTTAAAGCAACCAGTTGGT
GTTGTTGGTGCAATTACCCCATGGAATTTTCCCTTGGCTATGATTACCCGAAAGGTTGGCCCTGCTCTTGCTTGTGGTTGCACAGTGGTG
ATTAAACCGTCTGAACTCACACCCTTGACTGCTTTAGCAGCAGCTGAACTCTCCATTCAAGCTGGAATACCACCGGGCGTAGTGAATGTT
GTTATGGGAAATGCACCTGATATTGGAGACGCACTGCTTGCAAGCCCACAGGTAAGAAAAATTACATTCACAGGTTCAACCAAGGTTGGG
AAAAAATTGATGGAAGGTGCTGCTGCCACCGTTAAAAAGGTGTCTCTTGAGCTAGGCGGTAATGCACCTTGCATCATCTTTGATGACGCA
GATCTTGAAGTAGCTTTAAAAGGAGCTCTCGCAACAAAGTTCCGTAACACCGGACAAACATGTGTATGTGCGAACAGAATACTTGTGCAA
GAAGGGATATATGATAAATTCGCAAATGCTTTTGCTAAAGCTGTCCAAAACATGAAAGTTGGAGATGGTTTCACTGAAGGTGTAGAGCAA
GGCCCTCTAATCAATGAAGCAGCAGTACAGAAGGTTGAATATTTTGTGGATGAAGCTACTTCAAAGGGAGCCAAAGTCCTTGTTGGTGGG
AAGAGACACAGCCTTGGCATGACTTTCTACGAGCCTACAGTTGTTACTGGAGTTAACAGTGAGATGCTCTTGGCGAAAGAGGAAGTATTT
GGGCCAGTCGCCCCTCTTTTGAAGTTCAAAACAGACGAAGAAGCAATCCAAATGGCTAACGACACTAATGCTGGTTTAGCTGCTTATATA
TTCTCAACAAACATCAAAAGAGCTTGGCGTGTTACTGAAGCTCTCGAATATGGAATTGTCGGAGTTAATGAAGGACTAGTTTCAACCGAG
GTAGCTCCATTTGGGGGTGTGAAACAATCAGGTCTTGGCCGCGAAGGTTCTAAATACGGGATGGATGAATATTTAGAGATGAAATATGTG
TGCTTGGGAAGTATGAGCTAA(3')ATCACCACTGTAAAAAAAAAATTTCTCAATAATAAGAGACACAATGGTGCCAGTCTCATTTTGGG
TTTAATGAAGTTTTTCACGTCTTTATGAATGAAAAAAAAAAAAAAAAGTGAAAAAAAAAAAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan