ESTScan Details for Unigene SGN-U316472

Score 
321
Direction 
Forward
Predicted Peptide Sequence 
ALLCGXGPCASYLLRKRALYGDMTRYTCCAGYMPCSGRCGESRCPEFCLATEVFLCFGNSVASTRFMLQDEFNIQTTRCDNCIIETLSLS
LQVPHFTGFGVNPKVFRNTSLPAXVGFYVLPPTNACIFSIVAMIVGSEEIQEASQLLSCLSDMVYCTVCACMQTQHKVEMDKRDGKFGPQ
PMALPPVLHMSRLDQPYTPTGGYPPPAYGQPPPQQAYPA
Predicted Coding Sequence 
XCTGCTTTGCTTTGTGGTGXTGGACCATGTGCATCATATTTGCTTCGGAAACGAGCTCTCTATGGTGATATGACAAGGTACACATGCTGT
GCGGGTTATATGCCCTGCAGTGGTCGTTGTGGAGAAAGTCGTTGTCCTGAGTTTTGTTTAGCAACTGAGGTTTTTCTCTGCTTTGGAAAT
TCAGTGGCTTCCACCCGCTTCATGTTGCAAGATGAGTTCAACATACAAACAACGCGATGTGATAATTGCATTATTGAAACTCTCTCTCTC
TCTCTCCAAGTTCCCCATTTTACTGGATTTGGAGTGAATCCTAAGGTATTTCGTAACACATCTCTTCCTGCTXTTGTAGGGTTTTATGTT
CTGCCTCCAACAAATGCTTGCATATTTTCAATTGTTGCTATGATTGTTGGAAGTGAGGAGATCCAGGAAGCTTCTCAGCTGCTGTCATGT
TTGTCTGACATGGTCTACTGCACGGTTTGTGCCTGTATGCAAACACAACACAAGGTTGAAATGGACAAGAGAGATGGCAAGTTCGGTCCT
CAACCAATGGCACTGCCACCCGTGCTGCATATGTCACGACTAGATCAGCCTTACACGCCAACTGGTGGATATCCTCCTCCAGCTTATGGT
CAACCACCTCCACAACAAGCTTATCCAGCT
Edits in Original Sequence 
(5')XCTGCTTTGCTTTGTGGTGXTGGACCATGTGCATCATATTTGCTTCGGAAACGAGCTCTCTATGGTGATATGACAAGGTACACATG
CTGTGCGGGTTATATGCCCTGCAGTGGTCGTTGTGGAGAAAGTCGTTGTCCTGAGTTTTGTTTAGCAACTGAGGTTTTTCTCTGCTTTGG
AAATTCAGTGGCTTCCACCCGCTTCATGTTGCAAGATGAGTTCAACATACAAACAACGCGATGTGATAATTGCATTATTGtAAACTCTCT
CTCTCTCTCTCCAAGTTCCCCATTTTACTGGATTTGGAGTGAATCCgTAAGGTATTTCGTAACACATCTCTTCCTGCTXTTGTAGGGTTT
TATGTTCTGCCTCCAACAAAtTGCTTGCATATTTTCAATTGTTGCTATGATTGTTGGAAGTGAGGAGATCCAGGAAGCTTCTCAGCTGCT
GTCATGTTTGTCTGACATGGTCTACTGCACGGTTTGTGCCTGTATGCAAACACAACACAAGGTTGAAATGGACAAGAGAGATGGCAAGTT
CGGTCCTCAACCAATGGCACTGCCACCCGTGCTGCATATGTCACGACTAGATCAGCCTTACACGCCAACTGGTGGATATCCTCCTCCAGC
TTATGGTCAACCACCTCCACAACAAGCTTATCCAGCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan