ESTScan Details for Unigene SGN-U316508

Score 
460
Direction 
Forward
Predicted Peptide Sequence 
ALTGDIVALAGLKDTITGETLSDPEKPVVLERMDFPDPVIKVAIEPKTKADIDKMAQGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHL
EIIVDRLKREFKVEANVGAPQVNYRESISRNSEVKYVHKKQSGGSGQFADITVRFEPMEAGGGFFVPLAEMFNYVSTLRGMTKGRASYVM
QLAKFDVVPQHIQNQLAKKEEAAAAXVSHLPDFGSTNLKIGIFLDEDVKAWTTFFLYVPAWNTDGEXADIXVMRLSFFRRLCMLLSYKLR
LRRDGRKQEGNVYTCI
Predicted Coding Sequence 
GCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAAAGATACAATTACAGGAGAGACATTGTCTGATCCCGAGAAGCCTGTTGTGCTT
GAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATA
AAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTT
GAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGG
AACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCA
GGTGGTGGATTCTTTGTTCCATTAGCAGAGATGTTCAATTACGTTAGTACCTTGCGAGGAATGACAAAGGGGCGTGCATCGTATGTTATG
CAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCTGCTXTAGTCAGTCATCTT
CCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCA
TGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTGTTGAGTTATAAGCTGAGA
CTCCGAAGAGACGGAAGAAAGCAAGAAGGAAATGTGTATACATGCATTTAA
Edits in Original Sequence 
(5')GCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAAAGATACAATTACAGGAGAGACATTGTCTGATCCCGAGAAGCCTGTTGT
GCTTGAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTT
AATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACA
TCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTC
CAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGA
AGCAGGTGGTGGATTCTTTaGTTCCATTAGCAGAGATGTTCAATTACGTTAGTACCTTGCGAGGAATGACAAAGGGGCGTGCATCGTATG
TTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCTGCTXTAGTCAGTC
ATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTaCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTA
CCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTGTTGAGTTATAAG
CTGAGACTCCGAAGAGACGGAAGAAAGCAAGAAGGAAATGTGTATACATGCATTTAA(3')GATGTCTCTACATCCCAAAGAAGCATCAA
TATTTTAGGGCAAGATTGAGTGTGTCTCCGATTGTGGAATAATTTTCTTACTAAAAAATAAATATATGCTTTGTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan