ESTScan Details for Unigene SGN-U316509

Score 
1668
Direction 
Forward
Predicted Peptide Sequence 
QSETVWRQADKYGVPRICFVNKMDRLGANFFRTRDMIVTNLGAKPLVIQIPIGAEDTFKGLVDLVMMKAIVWSGEELGAKFSYEDIPADL
QELAEEYRALMIETVVELDDDVMEKYLEGVEPDEATIKQLIRKGTISGNFVPVLCGSAFKNKGVQPLLDAVVDYLPSPVDVPPMNGTDPD
NPEVIIERAPSDDEPFTGLAFKIMNDPFVGSLTFVRVYSGKLSAGSYVLNANKGRKERIGRLLEMHANSREDVKTALTGDIVALAGLKDT
ITGETLSDPEKPVVLERMDFPDPVIKVAIEPKTKADIDKMAQGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKREFKVEA
NVGAPQVNYRESISRNSEVKYVHKKQSGGSGQFADITVRFEPMEAGGGYEFKSEIKGGAVPKEYIPGVMKGLEECMSNGVLAGFPVVDVR
AVLVDGSYHDVDSSVLAFQLAARGAFREGMRKAGPQLLEPIMKVEVVTPEEHLGDVIGDLNSRRGQINSFGDKPGGLKVVDSLVPLAEMF
NYVSTLRGMTKGRASYVMQLAKFDVVPQHIQNQLAKKEEAAAAXVSHLPDFGSTNLKIGIFLDEDVKAWTTFFLYVPAWNTDGEXADIXV
MRLSFFRRLCMLLSYKLRLRRDGRKKEGNVYTCI
Predicted Coding Sequence 
XXTCAATCAGAAACTGTTTGGAGACAAGCTGATAAATACGGAGTCCCTAGGATATGTTTCGTAAATAAGATGGATCGTCTTGGAGCTAAT
TTCTTCCGAACAAGAGACATGATAGTAACAAACTTGGGTGCTAAACCACTTGTAATTCAGATACCAATTGGTGCAGAGGATACATTCAAA
GGATTAGTTGATCTTGTGATGATGAAAGCTATTGTTTGGTCCGGAGAAGAATTAGGGGCAAAGTTTTCCTATGAGGACATTCCTGCTGAT
CTTCAAGAGCTAGCTGAGGAGTATAGGGCACTGATGATTGAGACTGTAGTTGAATTGGATGATGATGTAATGGAGAAATACCTGGAAGGA
GTTGAACCTGATGAGGCAACCATCAAACAGTTGATCAGGAAGGGAACTATATCTGGTAATTTTGTCCCTGTATTGTGTGGCTCAGCTTTC
AAGAACAAGGGGGTTCAGCCGCTGCTCGATGCAGTTGTGGATTATTTGCCTTCTCCAGTTGACGTGCCACCCATGAATGGAACTGACCCT
GACAACCCAGAAGTAATCATTGAGAGGGCCCCTAGTGATGATGAACCATTTACTGGTTTGGCATTTAAGATCATGAATGATCCTTTTGTT
GGGTCTCTCACATTTGTTAGGGTATATTCAGGAAAGCTTAGTGCAGGATCGTATGTATTGAATGCAAACAAAGGCAGGAAAGAGAGAATT
GGCAGACTTCTGGAAATGCATGCTAACAGTAGAGAGGATGTAAAGACAGCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAAAGAT
ACAATTACAGGAGAGACATTGTCTGATCCCGAGAAGCCTGTTGTGCTTGAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGCAATT
GAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGAT
GAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAA
GCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGT
TCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCA
GTGCCAAAAGAATATATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTT
CGTGCTGTGCTAGTAGATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGG
ATGAGAAAAGCTGGTCCACAATTGCTAGAACCCATAATGAAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGGTGAC
CTTAACTCAAGGAGAGGCCAGATCAACAGCTTTGGAGACAAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGAGATG
TTCAATTACGTTAGTACCTTGCGAGGAATGACAAAGGGGCGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACAC
ATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCTGCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGT
ATTTTTCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTA
GTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTGTTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAGGAAAT
GTGTATACATGCATTTAA
Edits in Original Sequence 
(5')XXTCAATCAGAAACTGTTTGGAGACAAGCTGATAAATACGGAGTCCCTAGGATATGTTTCGTAAATAAGATGGATCGTCTTGGAGC
TAATTTCTTCCGAACAAGAGACATGATAGTAACAAACTTGGGTGCTAAACCACTTGTAATTCAGATACCAATTGGTGCAGAGGATACATT
CAAAGGATTAGTTGATCTTGTGATGATGAAAGCTATTGTTTGGTCCGGAGAAGAATTAGGGGCAAAGTTTTCCTATGAGGACATTCCTGC
TGATCTTCAAGAGCTAGCTGAGGAGTATAGGGCACTGATGATTGAGACTGTAGTTGAATTGGATGATGATGTAATGGAGAAATACCTGGA
AGGAGTTGAACCTGATGAGGCAACCATCAAACAGTTGATCAGGAAGGGAACTATATCTGGTAATTTTGTCCCTGTATTGTGTGGCTCAGC
TTTCAAGAACAAGGGGGTTCAGCCGCTGCTCGATGCAGTTGTGGATTATTTGCCTTCTCCAGTTGACGTGCCACCCATGAATGGAACTGA
CCCTGACAACCCAGAAGTAATCATTGAGAGGGCCCCTAGTGATGATGAACCATTTACTGGTTTGGCATTTAAGATCATGAATGATCCTTT
TGTTGGGTCTCTCACATTTGTTAGGGTATATTCAGGAAAGCTTAGTGCAGGATCGTATGTATTGAATGCAAACAAAGGCAGGAAAGAGAG
AATTGGCAGACTTCTGGAAATGCATGCTAACAGTAGAGAGGATGTAAAGACAGCGTTAACTGGTGATATTGTTGCTCTTGCTGGATTGAA
AGATACAATTACAGGAGAGACATTGTCTGATCCCGAGAAGCCTGTTGTGCTTGAGCGCATGGATTTCCCAGATCCTGTTATAAAGGTTGC
AATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACG
TGATGAGGAGATTAACCAGACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGT
GGAAGCTAATGTCGGAGCTCCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGG
TGGTTCAGGACAGTTTGCTGATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGG
TGCAGTGCCAAAAGAATATATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGA
TGTTCGTGCTGTGCTAGTAGATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGA
AGGGATGAGAAAAGCTGGTCCACAATTGCTAGAACCCATAATGAAGGTTGAAGTAGTTACACCAGAAGAACATCTAGGGGATGTGATTGG
TGACCTTAACTCAAGGAGAGGCCAGATCAACAGCTTTGGAGACAAGCCTGGAGGTCTCAAGGTGGTGGATTCTTTAGTTCCATTAGCAGA
GATGTTCAATTACGTTAGTACCTTGCGAGGAATGACAAAGGGGCGTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCA
ACACATTCAAAACCAGCTTGCCAAAAAGGAGGAAGCAGCTGCTGCTXTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAAT
AGGTATTTTTaCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATA
TTXTAGTCATGCGTCTGAGTTTTTTCAGACGTTTGTGTATGTTGTTGAGTTATAAGCTGAGACTCCGAAGAGACGGAAGAAAGAAAGAAG
GAAATGTGTATACATGCATTTAA(3')GATGTCTCTACATCCAAAAGAAGCATCAATATTTTAGGGCAAGATTGAGTGTGTCTCCGATTG
TGGGATTATTTTTCTTACTATAGAAATAAATATATGCTTTGTAACAATCTGATGCTCTTTATTGAGATCTTAGGTGTAACATCTGACGAT
TTTGAGTTGCTTATTTCACGTTTGTTTTTACTTTGCACTTCTGTTATAATATTACGTACCTAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan