ESTScan Details for Unigene SGN-U316536

Score 
654
Direction 
Forward
Predicted Peptide Sequence 
MAISSSSLSAALFPMCNSSSISAQPKFSLLSLHSNSVKLQVFNQSRVSTTKVFASPEVLDAQNVEADVEDILAASTLSIGGDSDKAAPKQ
KIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTVGPVPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQRLIDILYPTAQTIDKLMLLDLPA
GVDVEVKL
Predicted Coding Sequence 
ATGGCGATTTCATCGTCTTCACTCTCAGCAGCTCTTTTTCCAATGTGTAATTCATCTTCCATTTCTGCACAACCCAAGTTTTCTCTTCTG
TCTTTGCATTCAAATTCTGTTAAGTTACAAGTTTTCAACCAATCTCGAGTGTCTACAACTAAGGTTTTTGCTTCTCCTGAAGTTTTGGAT
GCCCAGAATGTTGAAGCTGATGTTGAGGATATTCTAGCTGCTTCAACGCTGAGTATTGGTGGTGACTCTGACAAGGCAGCTCCAAAGCAG
AAGATTAGGATCAAATTGAGGTCATACTGGGTACCCCTAATAGAAGACTCTTGTAAGCAAATTATGGATGCTGCAAGAACGACAAATGCA
AAGACCGTAGGTCCTGTACCACTGCCCACCAAAAAGAGAATTTACTGTGTCCTCAAATCTCCACATGTTCACAAAGATGCCAGGTTCCAT
TTCGAAATAAGAACTCATCAACGTCTTATTGACATTCTTTACCCGACTGCCCAAACTATCGACAAGTTAATGTTGCTTGACCTTCCTGCT
GGTGTTGATGTGGAGGTCAAGCTCTGA
Edits in Original Sequence 
TTGTATAGTTATTTCTCTTCTTCGGATAAGCTTTAAAACACAGAAAAATTGAAGAAGCTCCTAAGGAGGAGAGCTCCAATCTCCATTAGA
GACCAAATTCGAACTTTAGTGAATACCCAA
(5')ATGGCGATTTCATCGTCTTCACTCTCAGCAGCTCTTTTTCCAATGTGTAATTCATC
TTCCATTTCTGCACAACCCAAGTTTTCTCTTCTGTCTTTGCATTCAAATTCTGTTAAGTTACAAGTTTTCAACCAATCTCGAGTGTCTAC
AACTAAGGTTTTTGCTTCTCCTGAAGTTTTGGATGCCCAGAATGTTGAAGCTGATGTTGAGGATATTCTAGCTGCTTCAACGCTGAGTAT
TGGTGGTGACTCTGACAAGGCAGCTCCAAAGCAGAAGATTAGGATCAAATTGAGGTCATACTGGGTACCCCTAATAGAAGACTCTTGTAA
GCAAATTATGGATGCTGCAAGAACGACAAATGCAAAGACCGTAGGTCCTGTACCACTGCCCACCAAAAAGAGAATTTACTGTGTCCTCAA
ATCTCCACATGTTCACAAAGATGCCAGGTTCCATTTCGAAATAAGAACTCATCAACGTCTTATTGACATTCTTTACCCGACTGCCCAAAC
TATCGACAAGTTAATGTTGCTTGACCTTCCTGCTGGTGTTGATGTGGAGGTCAAGCTCTGA(3')GTAAAAAATTTCTCCTCCTTGTTTC
ACATCGTAACCTTGTCTATCTCTTGCTAGTTCCTTTCTGGTTTGGATTTTGTACTCATAGCGACACAATCATTTCTCAGGGAGAAGTAGG
GTAAACAGATATTTTTTTTCTGTGTAATGATTTGATTACTTGATTACTGAGCATCTTTTCAATCTCATATAAAAAAAAAAATAAAAAAAA
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan