ESTScan Details for Unigene SGN-U316631

Score 
411
Direction 
Forward
Predicted Peptide Sequence 
MAHYIFWDFTSAIGXFGLKADXFDEAMIKLHAIWKRSKTKENNYQESXVHGNFVMQETSEANFLGGVASAKRGGGFDTEAAKKRFLKMYL
LKSFEYAKPNSDIGFPGALELVSQCKKTGLEVAVAFSASDRNKVDANLAAAGLPITMVHIFTVYMQTHYSLVDNVVCKNKNSDENHRLDA
IVSADAX
Predicted Coding Sequence 
ATGGCCCATTATATCTTTTGGGATTTCACCTCAGCCATTGGTXCATTCGGTTTAAAGGCTGATGXATTTGATGAAGCAATGATTAAGCTC
CATGCAATATGGAAAAGAAGTAAAACAAAAGAAAATAATTATCAAGAATCTXCTGTCCATGGAAACTTTGTTATGCAAGAAACTAGTGAA
GCAAACTTCTTAGGTGGTGTTGCTTCTGCTAAGCGTGGTGGAGGATTTGATACCGAGGCTGCAAAGAAGAGGTTTCTAAAGATGTATCTT
TTAAAGTCATTTGAGTATGCAAAACCAAATTCTGACATAGGTTTCCCTGGTGCCTTAGAACTTGTCTCTCAGTGTAAAAAGACTGGTCTC
GAAGTTGCTGTTGCATTTAGTGCGTCTGACCGGAATAAAGTTGACGCAAACTTGGCTGCAGCAGGTTTACCAATAACAATGGTTCATATC
TTCACGGTATATATGCAAACACACTATTCTTTGGTTGATAATGTAGTTTGCAAGAACAAGAACTCGGATGAAAATCACAGGCTTGATGCA
ATTGTATCGGCTGATGCTTTX
Edits in Original Sequence 
GTCCCCAAAACAAGAGAGAAAAATGGCGTTGAAAGATTTTGTTCATGGACATGGATAAATTCTTCTTCTTCTTGGATACTCTCTTTACTG
GGAATTTCCCTTTTTTTGAACTAGTTCTTGATTGAGCAGTAATTTGTTGATTTATATGTTTATGGTTCAATGCTATTGTCAG
(5')ATGG
CCCATTATATCTTTTGGGATTTCACCTCAGCCATTGGTXCATTCGGTTTAAAGGCTGATGXATTTGATGAAGCAATGATTAAGCTCCATG
CAATATGGAAAAGAAGTAAAACAAAAGAAAATAATTATCAAGAATCTXCTGTCCATGGAAACTTTGTTATGCAAGAAACTAGTGAAGCAA
ACTTCTTAGGTGGTGTTGCTTCTGCTAAGCGTGGTGGaAGGATTTGATACCGAGGCTGCAAAGAAGAGGTTTCTAAAGATGTATCTTTTA
AAGTCATTTGtAGTATGCAAAACCAAATTCTGACATAGGTTTCCCTGGTGCCTTAGAACTTGTCTCTCAGTGTAAAAAGACTGGTCTCGA
AGTTGCTGTTGCATTTAGTGCGTCTGACCGGAATAAAGTTGACGCAAACTTGGCTGCAGCAGGTTTACCAATAACAATGGTTCATATCTT
CACGGTATATATGCAAACACACTATTCTTTGGTTGATAATGTAGTTTGCAAGAACAtAGAACTCGGATGAAAATCACAGGCTTGATGCAA
TTGTATCGGCTGATGCTTTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan