ESTScan Details for Unigene SGN-U316668

Score 
705
Direction 
Forward
Predicted Peptide Sequence 
MGCFNSKVKKQFRGHEDPIALASQTAFSVSEVEALFELFKSISSSVIDDGLISKEEFQLALFKNRKKENLFANRIFDLFDVKQKGVIDFG
DFVKGLHVFHPNAPQEEKVNFSFKLYDLDGTGFIERQEVKQMLIALLCESEMKLADETIESILDKTFVEADSNQDGKIDKSEWQIFVSQN
PSLLKIMTLPYLRDITTTFPSFVFHSEVDEVAT
Predicted Coding Sequence 
ATGGGCTGCTTTAATTCTAAGGTGAAAAAGCAGTTCCGTGGACACGAAGATCCTATTGCCCTTGCATCCCAAACAGCGTTTAGTGTTAGT
GAAGTTGAAGCATTGTTTGAGCTGTTCAAGAGTATCAGTAGTTCGGTAATTGATGATGGGCTAATAAGCAAGGAAGAATTTCAGTTGGCT
TTATTCAAGAACAGAAAGAAAGAAAACCTTTTTGCCAATCGGATTTTTGATCTCTTTGATGTGAAGCAAAAAGGGGTCATTGATTTTGGT
GATTTCGTGAAGGGACTTCATGTCTTCCACCCAAATGCACCACAAGAAGAGAAAGTCAATTTTTCGTTTAAGCTTTATGATCTAGATGGC
ACAGGGTTCATTGAGAGGCAAGAGGTTAAACAAATGTTGATTGCACTTTTATGCGAGTCTGAGATGAAGTTGGCTGATGAGACCATAGAG
AGTATACTGGATAAGACTTTTGTGGAAGCAGACTCAAATCAGGATGGAAAGATTGACAAATCCGAATGGCAGATTTTTGTGAGCCAAAAT
CCTTCACTACTAAAGATAATGACACTTCCCTATCTAAGGGATATTACAACTACTTTTCCTAGTTTCGTCTTCCATTCTGAAGTTGATGAA
GTTGCTACATAA
Edits in Original Sequence 
CTTTTCAGTCTCCCTCAGCTTCTTCTTCTCCAAAAGAACAGCTTTTTTTTTTCTCTGAGAACCAATCACAGCCGTTGATCATATCACCGG
TGTAGATGTGTGTGTACATATAGATTACACATATATACACACATTTATTCATGGATTTATCAAAACCCCTTTGAAAGTTTGCATCTTTTT
TGTTTGTGAAGCTGGTTTCTAGGCGCTTGTCTAGTCGTGCTTCTTCTTCAGTCACCATTCTCCAGTAA
(5')ATGGGCTGCTTTAATTCT
AAGGTGAAAAAGCAGTTCCGTGGACACGAAGATCCTATTGCCCTTGCATCCCAAACAGCGTTTAGTGTTAGTGAAGTTGAAGCATTGTTT
GAGCTGTTCAAGAGTATCAGTAGTTCGGTAATTGATGATGGGCTAATAAGCAAGGAAGAATTTCAGTTGGCTTTATTCAAGAACAGAAAG
AAAGAAAACCTTTTTGCCAATCGGATTTTTGATCTCTTTGATGTGAAGCAAAAAGGGGTCATTGATTTTGGTGATTTCGTGAAGGGACTT
CATGTCTTCCACCCAAATGCACCACAAGAAGAGAAAGTCAATTTTTCGTTTAAGCTTTATGATCTAGATGGCACAGGGTTCATTGAGAGG
CAAGAGGTTAAACAAATGTTGATTGCACTTTTATGCGAGTCTGAGATGAAGTTGGCTGATGAGACCATAGAGAGTATACTGGATAAGACT
TTTGTGGAAGCAGACTCAAATCAGGATGGAAAGATTGACAAATCCGAATGGCAGATTTTTGTGAGCCAAAATCCTTCACTACTAAAGATA
ATGACACTTCCCTATCTAAGGGATATTACAACTACTTTTCCTAGTTTCGTCTTCCATTCTGAAGTTGATGAAGTTGCTACATAA(3')CA
CTAGGAAAATGTAGTTCATTTTTTGTTTTTCTAGCTAATTCGACGTGTGAAGTGTTGTTCGATTTTTGGTCTTATTTTAGAGTTCAGGAA
GTTGAGCTGATGATAATCCTAAAAAGTGTATATCACGTCGTGTAAAGAGGGTTCCACCTTCCTATTGCAGAGTGATTTTATTAGATCTAG
TTATTGTGTACTTTTATCAATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan