ESTScan Details for Unigene SGN-U316686

Score 
1135
Direction 
Forward
Predicted Peptide Sequence 
RNCVSLKAAAMGNCCSDVAGGQTAVGGTGVNQGNQPNAPNEAVDAFLKSRGYQGLYSQIELSLSATSLRDRDVLSKSDPMAVLYSKEKDG
SLKELTRTEVVLNSLNPKWITKYTMAYYFETVQNLVFRVYDIDTQFHNQDVKMLKLEEQDFLGEASCTLAQIVTKSDRSLTMDLVCGEQF
SGQAHARKFGKLTIFAEESISSKTTVELKLRCSELESKDLFSKSDPFLVVSKTTESGIVVPICKTEVMKNDHSPTWKPVFLKIQQIGSKE
NPLIIECYDFNSNGKHSLIGKIQKSLLDLEKLHSAGTGANLFIPTAMGPKQENKVLKSQLFVESYSEKIQYTFLDYLAFGYELNFMVAID
FTASNGNPRLPDSLHYIDPSGRPNAYQRAILDVGEVLQFYDSDKRFPAWGFGARPIDGPVSHCFNLNGSSTYCEVEGIQGIMMAYISALH
NVSLAGPTLFGPVITSAAHIASQSLTNNEXEVFRFTNYHGWSNNRSPRKKDALVQAADLPLSILIVGVGGADFKEMEILDADKGERLEST
TGRVAVRDIVQFVPLRDVQNGDVSVVQSLLAELPSQLLEYMRSRKIQPTL
Predicted Coding Sequence 
AGAAATTGTGTCTCTTTGAAAGCGGCGGCCATGGGAAATTGCTGCTCTGATGTTGCCGGTGGACAGACGGCAGTCGGCGGTACCGGAGTT
AACCAAGGAAATCAACCAAATGCCCCTAACGAAGCCGTCGATGCTTTCCTTAAGTCTCGTGGTTACCAAGGCCTCTACTCTCAGATCGAG
TTGTCTCTATCTGCTACCAGCTTACGTGATCGTGATGTGCTTTCCAAGAGTGACCCTATGGCAGTTCTTTATTCAAAAGAAAAAGATGGT
TCATTGAAAGAGCTTACCCGTACTGAAGTAGTTCTGAACTCATTGAACCCAAAGTGGATTACAAAATATACTATGGCTTATTATTTTGAG
ACGGTGCAGAATTTGGTGTTCCGTGTGTATGATATTGACACTCAATTTCATAATCAAGATGTCAAGATGCTTAAACTGGAGGAGCAGGAC
TTTCTTGGTGAGGCCAGTTGCACATTGGCTCAGATTGTCACAAAATCTGACAGATCCCTGACCATGGACCTTGTATGTGGCGAACAATTT
TCTGGTCAAGCACATGCACGGAAGTTTGGCAAGCTTACAATTTTTGCTGAAGAAAGTATCAGCTCAAAAACTACAGTCGAGTTGAAATTA
AGATGTTCAGAATTGGAATCGAAAGATTTGTTTTCAAAAAGTGATCCATTTCTGGTGGTATCCAAAACTACTGAAAGTGGAATTGTCGTT
CCAATTTGCAAAACAGAAGTGATGAAAAATGATCATTCACCCACCTGGAAACCGGTGTTCTTGAAAATTCAACAAATTGGAAGTAAGGAG
AACCCACTAATTATCGAGTGTTATGACTTCAATAGCAATGGCAAGCATAGTTTAATTGGAAAGATTCAGAAGTCACTATTAGATTTAGAA
AAGTTGCATTCTGCGGGTACTGGTGCAAATCTTTTTATACCAACTGCTATGGGACCAAAACAAGAAAACAAGGTTCTAAAGAGCCAACTT
TTCGTGGAAAGCTATTCTGAGAAAATACAGTATACATTCCTTGATTACTTGGCGTTTGGCTATGAACTCAACTTCATGGTGGCCATTGAC
TTTACTGCTTCCAATGGAAATCCACGGCTCCCTGATTCATTACATTATATTGACCCTTCAGGACGACCAAATGCTTATCAGAGAGCAATC
CTGGATGTTGGGGAGGTATTGCAGTTTTATGATTCAGACAAACGTTTTCCTGCTTGGGGGTTTGGAGCACGGCCAATTGATGGCCCAGTT
TCTCATTGCTTCAACTTAAACGGTAGCAGTACTTACTGTGAGGTGGAAGGAATCCAGGGTATCATGATGGCATACATTAGTGCCCTTCAT
AATGTTTCACTTGCAGGTCCAACTTTATTTGGACCCGTTATTACTTCTGCTGCACATATAGCAAGTCAGTCTTTGACGAACAATGAGCXG
GAAGTATTTCGTTTTACTAATTATCACGGATGGAGTAATAACAGATCTCCAAGAAAGAAGGATGCTCTTGTTCAAGCAGCGGATTTGCCA
TTGTCAATTCTAATTGTTGGGGTTGGAGGTGCAGACTTTAAGGAAATGGAGATACTGGATGCTGATAAAGGAGAGAGACTAGAATCTACA
ACTGGACGTGTTGCTGTTCGTGATATAGTACAATTTGTTCCCCTCCGTGATGTACAAAATGGAGATGTCTCAGTCGTTCAATCACTTTTA
GCAGAATTACCTTCTCAGTTGTTGGAATACATGCGGTCCAGAAAGATACAGCCAACTTTGTGA
Edits in Original Sequence 
(5')AGAAATTGTGTCTCTTTGAAAGCGGCGGCCATGGGAAATTGCTGCTCTGATGTTGCCGGTGGACAGACGGCAGTCGGCGGTACCGG
AGTTAACCAAGGAAATCAACCAAATGCCCCTAACGAAGCCGTCGATGCTTTCCTTAAGTCTCGTGGTTACCAAGGCCTCTACTCTCAGAT
CGAGTTGTCTCTATCTGCTACCAGCTTACGTGATCGTGATGTGCTTTCCAAGAGTGACCCTATGGCAGTTCTTTATTCAAAAGAAAAAGA
TGGTTCATTGAAAGAGCTTACCCGTACTGAAGTAGTTCTGAACTCATTGAACCCAAAGTGGATTACAAAATATACTATGGCTTATTATTT
TGAGACGGTGCAGAATTTGGTGTTCCGTGTGTATGATATTGACACTCAATTTCATAATCAAGATGTCAAGATGCTTAAACTGGAGGAGCA
GGACTTTCTTGGTGAGGCCAGTTGCACATTGGCTCAGATTGTCACAAAATCTGACAGATCCCTGACCATGGACCTTGTATGTGGCGAACA
ATTTTCTGGTCAAGCACATGCACGGAAGTTTGGCAAGCTTACAATTTTTGCTGAAGAAAGTATCAGCTCAAAAACTACAGTCGAGTTGAA
ATTAAGATGTTCAGAATTGGAATCGAAAGATTTGTTTTCAAAAAGTGATCCATTTCTGGTGGTATCCAAAACTACTGAAAGTGGAATTGT
CGTTCCAATTTGCAAAACAGAAGTGATGAAAAATGATCATTCACCCACCTGGAAACCGGTGTTCTTGAAAATTCAACAAATTGGAAGTAA
GGAGAACCCACTAATTATCGAGTGTTATGACTTCAATAGCAATGGCAAGCATAGTTTAATTGGAAAGATTCAGAAGTCACTATTAGATTT
AGAAAAGTTGCATTCTGCGGGTACTGGTGCAAATCTTTTTATACCAACTGCTATGGGACCAAAACAAGAAAACAAGGTTCTAAAGAGCCA
ACTTTTCGTGGAAAGCTATTCTGAGAAAATACAGTATACATTCCTTGATTACTTGGCGTTTGGCTATGAACTCAACTTCATGGTGGCCAT
TGACTTTACTGCTTCCAATGGAAATCCACGGCTCCCTGATTCATTACATTATATTGACCCTTCAGGACGACCAAATGCTTATCAGAGAGC
AATCCTGGATGTTGGGGAGGTATTGCAGTTTTATGATTCAGACAAACGTTTTCCTGCTTGGGGGTTTGGAGCACGGCCAATTGATGGCCC
AGTTTCTCATTGCTTCAACTTAAACGGTAGCAGTACTTACTGTGAGGTGGAAGGAATCCAGGGTATCATGATGGCATACATTAGTGCCCT
TCATAATGTTTCACTTGCAGGTCCAACTTTATTTGGACCCGTTATTACTTCTGCTGCACATATAGCAAGTCAGTCTTTGACGAACAATGA
GCXGGAAGTATTTCGTTTTACTAATTATCACGGATGGAGTAATAACAGATCTCCAAGAAAcGAAGGATGCTCTTGTTCAAGCAGCGGATT
TGCCATTGTCAATTCTAATTGTTGGGGTTGGAGGTGCAGACTTTAAGGAAATGGAGATACTGGATGCTGATAAAGGAGAGAGACTAGAAT
CTACAACTGGACGTGTTGCTGTTCGTGATATAGTACAATTTGTTCCCCTCCGTGATGTACAAAATGGAGATGTCTCAGTCGTTCAATCAC
TTTTAGCAGAATTACCTTCTCAGTTGTTGGAATACATGCGGTCCAGAAAGATACAGCCAACTTTGTGA(3')TCGATCATACAAGACTTG
TACATAAATTTTGCTTCAGAAGATTAAGCTGATATCTTTCATCAGCATAGTCTTGTAATTGATTTTGTTGATAAAAAAAAAAAAACTCAA
CTCCGTTGCCCTTTATACTTGCAAATTCTAATCTCCTTTCTGTTACAGTTACCTTCCAGTTGTCCGTTGTAACTGTCATGTTTAAGGCTG
TAAGCAGTAACTATAATTTTTTCCTATTTTAAATCCCTGAAGAAAGCAAAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan