ESTScan Details for Unigene SGN-U316749

Score 
679
Direction 
Forward
Predicted Peptide Sequence 
MKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKEKKLTITGNIDPVSLVSKLRKLCHTDIVSVGPAKEPEKKKDDGAKKDEGAKKD
DGKKDDGAKKGDDKKGGADKTKEEALPVMKAFPAPIFYHYNQHPYQHYQTPVPAYYHQRSVEEDPNSCVIC
Predicted Coding Sequence 
ATGAAGAAAGTAATTCTGAAATTGGAGTATTTCGACGAGAAAATCAAGCAGAAAGCCATGAAGAAAGTGTCTGGTCTTGAAGGAGTGGAA
TCAATTTCAATAGATTCAAAAGAGAAGAAATTAACAATTACAGGGAACATAGATCCAGTTTCACTGGTTTCAAAATTGAGGAAGCTCTGT
CACACTGATATCGTCTCAGTTGGACCAGCAAAAGAGCCTGAGAAAAAGAAGGACGACGGTGCCAAAAAAGATGAAGGGGCTAAAAAGGAT
GACGGCAAAAAAGATGATGGGGCTAAAAAAGGGGATGATAAAAAAGGAGGAGCCGATAAGACGAAAGAAGAAGCTCTTCCAGTAATGAAA
GCTTTTCCAGCTCCTATATTTTATCACTATAATCAGCATCCTTATCAACATTATCAAACCCCTGTTCCTGCTTATTATCACCAACGAAGC
GTTGAAGAAGATCCAAATTCTTGTGTCATCTGTTGA
Edits in Original Sequence 
AAAAAAAAAACCCCCCAAAATTTTTAAAATTCCCAATTTTTTTGGAAAAGGTTTTTTTTTTTTTTNNAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTTCTCATTTCTCTTTTCTCTTTCTTCTATTTGTCTTTCATTCCTTTGAA
TATTCTCTTCTATTTAGAGACGGAATAATAACAATCTTACAAAAAGTAAGAAAACAGTTCTTTATCTGATACTTTGTAAGATACACCAGC
AAAAGCAGATCTCTAATTATCAGCATATTTAAAG
(5')ATGAAGAAAGTAATTCTGAAATTGGAGTATTTCGACGAGAAAATCAAGCAGA
AAGCCATGAAGAAAGTGTCTGGTCTTGAAGGAGTGGAATCAATTTCAATAGATTCAAAAGAGAAGAAATTAACAATTACAGGGAACATAG
ATCCAGTTTCACTGGTTTCAAAATTGAGGAAGCTCTGTCACACTGATATCGTCTCAGTTGGACCAGCAAAAGAGCCTGAGAAAAAGAAGG
ACGACGGTGCCAAAAAAGATGAAGGGGCTAAAAAGGATGACGGCAAAAAAGATGATGGGGCTAAAAAAGGGGATGATAAAAAAGGAGGAG
CCGATAAGACGAAAGAAGAAGCTCTTCCAGTAATGAAAGCTTTTCCAGCTCCTATATTTTATCACTATAATCAGCATCCTTATCAACATT
ATCAAACCCCTGTTCCTGCTTATTATCACCAACGAAGCGTTGAAGAAGATCCAAATTCTTGTGTCATCTGTTGA(3')ACTGATATTCAT
GATGAATTTGATTCATATCATGTTATCACTGTTACTCTCTAATATATATTCCCTGCGAGTTTTGTGACTTTTTAAGAAGAAAAAAAATAG
CTTTGTACAAATTTATGTTTTCTTTTCCCCATGATCACATTTTTGTTCCATGTTTATTACAACATCTCTTTATTGATCTATATATTTGAA
CAGTGAACGGTGATTTAAAGGTCAAAANAAAAAAAAAAAAAANAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan