ESTScan Details for Unigene SGN-U316944

Score 
1108
Direction 
Forward
Predicted Peptide Sequence 
MDESKEETKSFKELGVCDQLIEACDNLGWKNPSKIQAEAMPHAFEGKDLIGLAQTGSGKTGAFAIPILQSLLDSPHAFFACVLSPTRELA
IQIAEQFEALGSGIGVKCAVLVGGIDQVQQSIALGKRPHIVVATPGRXLGSSFQYQRVFSPYDKVLGIRXGGQVANEDFEKALDQILNAI
PHERRTYLFSATMTKKVRKLQRACLRNPVKIEAASKYSTVDTLKQQYRFLPAKYKDCYLIYILTEMSGSTSMVFTRTCDATRLLALMLRN
LGLRAIPISGQMTQDKRLGALNKFKAGECNILICTDVASRGLDIPSVDMVINYDIPTNSKDYIHRVGRTARAGRSGVAISLVNQYELEWY
IQIEKLIGKKLPEYPAEEEEVLLLLERVTEAKRISLMKIKETGGKRKHRGGGDDGDDQEVHKYLGVNKKGKQSKKPKRK
Predicted Coding Sequence 
ATGGATGAATCCAAAGAAGAAACGAAGTCTTTCAAAGAATTAGGAGTTTGTGATCAATTGATTGAGGCTTGTGATAATTTGGGTTGGAAA
AACCCTTCTAAGATACAAGCTGAAGCTATGCCTCATGCCTTTGAAGGCAAAGACCTAATTGGTCTGGCACAAACGGGTTCTGGAAAGACG
GGAGCTTTTGCAATTCCTATACTGCAATCCTTATTAGATTCTCCGCATGCCTTTTTTGCCTGTGTTCTCTCTCCAACAAGAGAGCTCGCC
ATTCAAATTGCTGAACAGTTTGAAGCTTTAGGATCCGGTATTGGAGTAAAATGTGCAGTGCTGGTTGGAGGGATAGATCAAGTACAACAG
AGCATTGCCCTCGGGAAACGACCTCACATTGTTGTTGCAACACCTGGTCGCCXTCTTGGATCATCTTTCCAATACCAAAGGGTTTTCTCT
CCGTACGATAAAGTACTTGGTATTAGATGAGGCGGACAGGTTGCAAATGAGGATTTTGAGAAGGCCCTCGATCAGATTTTGAATGCTATT
CCCCATGAACGAAGGACTTATCTCTTTTCTGCTACAATGACCAAAAAGGTGCGGAAACTTCAGAGGGCTTGTTTGAGAAATCCTGTTAAG
ATTGAAGCTGCATCTAAATATTCCACCGTTGATACACTGAAGCAGCAGTATCGTTTTCTTCCTGCTAAATATAAGGACTGCTATCTTATC
TATATTCTGACTGAGATGTCTGGCAGTACATCTATGGTTTTCACTCGCACATGTGATGCAACTCGTCTTCTGGCTTTGATGCTTCGCAAC
CTAGGCTTGAGAGCCATACCAATTAGTGGTCAGATGACTCAGGATAAAAGGCTTGGAGCTCTAAACAAATTTAAGGCCGGAGAGTGCAAT
ATCCTTATATGCACTGATGTGGCCAGTCGAGGACTTGATATACCGTCTGTTGATATGGTTATCAACTATGATATTCCAACAAACTCAAAG
GATTATATACATAGAGTGGGAAGAACTGCACGAGCAGGACGTTCCGGGGTTGCCATATCATTAGTAAATCAGTATGAGTTGGAGTGGTAT
ATACAGATAGAAAAGCTTATTGGGAAGAAACTACCCGAGTATCCCGCAGAGGAAGAGGAGGTTTTGCTACTCTTGGAGCGTGTCACAGAA
GCCAAAAGGATCTCATTGATGAAAATCAAAGAAACTGGTGGGAAAAGGAAACACAGAGGTGGTGGAGATGATGGTGACGATCAAGAGGTT
CATAAATACTTGGGAGTTAATAAGAAGGGAAAACAATCAAAGAAGCCAAAGAGAAAATGA
Edits in Original Sequence 
CTTGGTTTTTTCTTCTTTCTTCTCCGGCGTCTCTTCACTTCTCTCTGCGTAATTTTTCTGCGTTTCTTCTCTGCGATTCTCGTTACTGTC
ATAATAGAACCCTCTGTGGAGAAGTCTTGGATCTGCGGCTAA
(5')ATGGATGAATCCAAAGAAGAAACGAAGTCTTTCAAAGAATTAGG
AGTTTGTGATCAATTGATTGAGGCTTGTGATAATTTGGGTTGGAAAAACCCTTCTAAGATACAAGCTGAAGCTATGCCTCATGCCTTTGA
AGGCAAAGACCTAATTGGTCTGGCACAAACGGGTTCTGGAAAGACGGGAGCTTTTGCAATTCCTATACTGCAATCCTTATTAGATTCTCC
GCATGCCTTTTTTGCCTGTGTTCTCTCTCCAACAAGAGAGCTCGCCATTCAAATTGCTGAACAGTTTGAAGCTTTAGGATCCGGTATTGG
AGTAAAATGTGCAGTGCTGGTTGGAGGGATAGATCAAGTACAACAGAGCATTGCCCTCGGGAAACGACCTCACATTGTTGTTGCAACACC
TGGTCGCCXTCTTGGATCATCTTTCCAATACCAAAGGGTTTTCTCTCCGTACGATAAAGTACTTGGTATTAGATGAGGCGGACAGGTTGC
tAAATGAGGATTTTGAGAAGGCCCTCGATCAGATTTTGAATGCTATTCCCCATGAACGAAGGACTTATCTCTTTTCTGCTACAATGACCA
AAAAGGTGCGGAAACTTCAGAGGGCTTGTTTGAGAAATCCTGTTAAGATTGAAGCTGCATCTAAATATTCCACCGTTGATACACTGAAGC
AGCAGTATCGTTTTCTTCCTGCTAAATATAAGGACTGCTATCTTATCTATATTCTGACTGAGATGTCTGGCAGTACATCTATGGTTTTCA
CTCGCACATGTGATGCAACTCGTCTTCTGGCTTTGATGCTTCGCAACCTAGGCTTGAGAGCCATACCAATTAGTGGTCAGATGACTCAGG
ATAAAAGGCTTGGAGCTCTAAACAAATTTAAGGCCGGAGAGTGCAATATCCTTATATGCACTGATGTGGCCAGTCGAGGACTTGATATAC
CGTCTGTTGATATGGTTATCAACTATGATATTCCAACAAACTCAAAGGATTATATACATAGAGTGGGAAGAACTGCACGAGCAGGACGTT
CCGGGGTTGCCATATCATTAGTAAATCAGTATGAGTTGGAGTGGTATATACAGATAGAAAAGCTTATTGGGAAGAAACTACCCGAGTATC
CCGCAGAGGAAGAGGAGGTTTTGCTACTCTTGGAGCGTGTCACAGAAGCCAAAAGGATCTCATTGATGAAAATCAAAGAAACTGGTGGGA
AAAGGAAACACAGAGGTGGTGGAGATGATGGTGACGATCAAGAGGTTCATAAATACTTGGGAGTTAATAAGAAGGGAAAACAATCAAAGA
AGCCAAAGAGAAAATGA(3')GGGAATTAATGTGTAAACTAATTTAGCAATTGTTTAGTCCAATTTTGACTTGGTTATTTATTTTATTAT
TGTTTACTCATTTAGGGGACTAAATTTGACATTTCATGAATTTGTGTTTTTGTTGTCAATGATAATATTTTCTTATATATACGTATAAAA
AAGTAATTGATACGCCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan