ESTScan Details for Unigene SGN-U317036

Score 
163
Direction 
Forward
Predicted Peptide Sequence 
MGSFMYIAILLAAKSQPSIPARHXDRAALLSFRAALNESHLGIFNSWKGNDCCHEWYGVSCDPTTHRVADINLRGESEDPLFEKAHRTGY
MTGTDISIYMQIRKAIKSHHADWKGITGSIPSCITSLPFLRIIDLVGNKLTGSIPSTIGRLSRLTVLNVAENQLTGYIPRSLTNLSSLMH
LDLRNNGIYGNIPTNFGKLRMLSRALLSRNKLTGPIPYSISYIYRLSDLDLSLNKLSGTIPPSLGKMHVLATLNLDGNHISGTIPPSLMN
SRINILNLSKNAMEGYIPDSFDEKSYFMVMDLSYNKLKGSIPKSISSATFIGHLDVSHNHLCGQIPEGSPFDHLEASSFTYNDCLCGKPL
KPCR
Predicted Coding Sequence 
ATGGGCAGCTTCATGTACATTGCCATCCTACTTGCTGCCAAATCTCAACCGTCCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTA
TCATTCCGAGCTGCCCTAAATGAATCTCACTTGGGTATTTTCAACTCATGGAAAGGCAACGACTGTTGCCATGAGTGGTACGGGGTGAGT
TGTGATCCCACAACTCACCGCGTAGCAGATATAAACCTTCGAGGTGAATCCGAAGATCCACTCTTTGAAAAAGCTCATCGTACCGGTTAC
ATGACCGGTACXGATATCTCCATCTATATGCAAATTAGAAAGGCTATCAAGTCTCACCATGCTGATTGGAAAGGCATTACTGGATCTATA
CCTTCATGTATTACATCCTTACCATTCCTTCGAATCATAGACTTAGTCGGAAACAAGCTCACCGGCTCAATCCCTTCAACTATAGGTCGA
TTAAGTCGACTCACTGTATTAAACGTAGCTGAAAATCAACTTACAGGGTACATACCCCGGTCATTAACCAACTTATCCTCATTAATGCAT
TTAGATCTCCGAAACAACGGTATCTACGGTAACATCCCGACTAATTTCGGAAAATTACGGATGTTGAGTCGAGCTTTACTGAGTCGAAAC
AAGTTAACAGGTCCTATACCGTATTCGATTTCGTATATTTACAGGCTTTCAGATTTGGATCTGTCATTGAACAAACTGTCTGGTACCATA
CCTCCGTCTCTTGGTAAAATGCACGTACTTGCAACGTTAAATCTTGATGGTAACCATATTTCTGGTACGATACCTCCTAGTTTGATGAAT
TCACGTATCAACATTTTGAATTTGAGTAAAAATGCTATGGAAGGTTATATTCCCGATTCATTTGACGAAAAATCTTATTTTATGGTAATG
GATTTATCTTATAACAAATTAAAAGGAAGCATTCCAAAATCGATATCGTCGGCGACGTTTATCGGTCACCTTGATGTAAGTCATAACCAT
CTTTGTGGACAGATTCCAGAAGGTTCTCCGTTTGATCATCTGGAAGCTTCATCTTTTACTTACAATGATTGTCTATGTGGGAAGCCTCTT
AAACCTTGTCGCTAA
Edits in Original Sequence 
AGAAAGTAAATTTTAAGAGAGAGAAACAAAAACAAACCGTCCTCATG(5')ATGGGCAGCTTCATGTACATTGCCATCCTACTTGCTGCC
AtAATCTCAACCGTCCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTATCATTCCGAGCTGCCCTAAATGAATCTCACTTGGGTAT
TTTCAACTCATGGAAAGGCAACGACTGTTGCCATGAGTGGTACGGGGTGAGTTGTGATCCCACAACTCACCGCGTAGCAGATATAAACCT
TCGAGGTGAATCCGAAGATCCACTCTTTGAAAAAGCTCATCGTACCGGTTACATGACCGGTACXGATATCTCCATCTATATGCAAATTAG
AAAGGCTATCAAGTCTCACCATaGCTGATTGGAAAGGCATTACTGGATCTATACCTTCATGTATTACATCCTTACCATTCCTTCGAATCA
TAGACTTAGTCGGAAACAAGCTCACCGGCTCAATCCCTTCAACTATAGGTCGATTAAGTCGACTCACTGTATTAAACGTAGCTGAAAATC
AACTTACAGGGTACATACCCCGGTCATTAACCAACTTATCCTCATTAATGCATTTAGATCTCCGAAACAACGGTATCTACGGTAACATCC
CGACTAATTTCGGAAAATTACGGATGTTGAGTCGAGCTTTACTGAGTCGAAACAAGTTAACAGGTCCTATACCGTATTCGATTTCGTATA
TTTACAGGCTTTCAGATTTGGATCTGTCATTGAACAAACTGTCTGGTACCATACCTCCGTCTCTTGGTAAAATGCACGTACTTGCAACGT
TAAATCTTGATGGTAACCATATTTCTGGTACGATACCTCCTAGTTTGATGAATTCACGTATCAACATTTTGAATTTGAGTAAAAATGCTA
TGGAAGGTTATATTCCCGATTCATTTGACGAAAAATCTTATTTTATGGTAATGGATTTATCTTATAACAAATTAAAAGGAAGCATTCCAA
AATCGATATCGTCGGCGACGTTTATCGGTCACCTTGATGTAAGTCATAACCATCTTTGTGGACAGATTCCAGAAGGTTCTCCGTTTGATC
ATCTGGAAGCTTCATCTTTTACTTACAATGATTGTCTATGTGGGAAGCCTCTTAAACCTTGTCGCTAA(3')AGTGTAGGTATTATTTTT
TTAAAATTTTTTTTTTATTAACACTATATATTGGTGAATATGTTTGTATTATTATGTGAAGAGTAAAGTGTTTTTTTTAAGCATATAGTT
GTGATTTTAAATGTATAATTGTGCTTCGGGATATATGAAGGCTTTCTTTTATATATATATATATATATATATATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan