ESTScan Details for Unigene SGN-U317064

Score 
453
Direction 
Reverse
Predicted Peptide Sequence 
SPSDTRAVTLPLTEEVIEKGRDGETEQVQNEEMPPQPTPEMINQVLAYLSGLSDQGQAPPVFSAPTPPVSEVQHAATMAPRMDVPLDIGT
FPRLTTVPIMTNDQHELFSKFLKLKPPVFKGAESEDAYDFLVDCHELLHKMGIVERFGVEFVTYQFQGNAQMWWRSHIECQPIEASPMTW
ASFYSLFMEKYIPRTLRDKKRDEFLSLEQGRVSVNAYEAKFVHYPDMPLNSVSVLKSGFAGXVKGLRSELRISSLQVAATAKSFQEVVDF
VIEVEGVKPDDFTTTSTSKRFRKGGEFKGSYSRGQGSGGYSARPIQSSLQTVVGGPPQTGQHFSKGPMSDSRECYGCGEIGHIRINCPGP
SYRPPIARGRGGHGRGRYSGGRGGRGNGGHQNGRGNGQTGATTSQHGRGNGQTNDRAHCYAFPGRSEAEASDAVITGNLLVCDCMASVLF
DPGSTFSYVSSSFANGLNLHCEFLDMPIR
Predicted Coding Sequence 
AGCCCATCTGATACTAGGGCAGTGACTCTTCCACTGACTGAGGAAGTAATAGAGAAAGGGAGGGATGGGGAAACTGAACAAGTGCAAAAT
GAGGAAATGCCACCCCAACCTACCCCAGAGATGATCAATCAGGTTCTGGCTTATCTTAGCGGGTTATCTGATCAAGGTCAAGCACCTCCA
GTGTTTTCTGCGCCAACACCTCCGGTTTCAGAAGTACAACATGCGGCTACTATGGCTCCCCGCATGGATGTTCCATTGGACATAGGCACA
TTTCCACGTTTGACTACTGTCCCTATAATGACAAATGATCAGCATGAACTTTTCAGTAAGTTCTTGAAATTGAAACCTCCGGTCTTCAAG
GGTGCTGAATCGGAGGATGCTTATGATTTTCTGGTTGACTGTCACGAGCTACTACACAAGATGGGTATAGTAGAACGGTTTGGTGTGGAG
TTTGTGACTTATCAGTTTCAAGGGAACGCCCAAATGTGGTGGCGGTCACATATCGAGTGTCAACCAATAGAGGCATCACCTATGACTTGG
GCCTCATTCTATAGTTTGTTTATGGAGAAGTATATCCCCCGGACTTTGAGGGATAAGAAAAGGGATGAGTTCTTGAGCCTAGAGCAAGGT
AGGGTGTCAGTTAATGCTTATGAGGCTAAGTTTGTGCACTATCCAGATATGCCACTCAACTCTGTTTCAGTCCTCAAGAGCGGATTCGCC
GGTXTTGTGAAGGGGTTGAGGTCAGAATTGCGGATTTCGTCCTTACAGGTAGCGGCAACGGCAAAATCCTTCCAAGAAGTGGTAGACTTT
GTGATAGAAGTGGAAGGAGTGAAGCCAGACGACTTCACCACGACATCGACATCAAAGAGGTTTCGAAAGGGAGGTGAGTTTAAGGGTTCT
TACTCTAGAGGACAAGGTTCCGGAGGTTACTCAGCTCGACCCATTCAGTCTTCACTACAGACTGTAGTTGGGGGTCCACCTCAGACCGGT
CAACACTTCTCCAAGGGGCCTATGAGTGACTCCAGAGAATGTTATGGATGTGGGGAGATTGGACATATTAGGATAAATTGTCCCGGACCA
AGTTATAGACCCCCAATAGCTAGAGGTAGAGGTGGTCATGGTAGAGGCCGTTATTCTGGAGGACGTGGTGGTCGAGGTAATGGTGGTCAC
CAAAACGGCAGAGGTAATGGGCAAACTGGGGCCACTACATCACAACATGGTAGGGGCAATGGGCAGACAAACGATAGGGCCCATTGTTAC
GCTTTCCCTGGGCGGTCTGAAGCGGAGGCATCTGATGCTGTCATCACAGGTAATCTTCTAGTTTGTGATTGCATGGCTTCCGTATTGTTT
GATCCTGGATCCACGTTTTCTTATGTATCTTCCTCATTTGCTAATGGTCTAAATTTACATTGTGAATTTCTTGATATGCCTATTCGT
Edits in Original Sequence 
(5')AGCCCATCTGATACTAGGGCAGTGACTCTTCCACTGACTGAGGAAGTAATAGAGAAAGGGAGGGATGGGGAAACTGAACAAGTGCA
AAATGAGGAAATGCCACCCCAACCTACCCCAGAGATGATCAATCAGGTTCTGGCTTATCTTAGCGGGTTATCTGATCAAGGTCAAGCACC
TCCAGTGTTTTCTGCGCCAACACCTCCGGTTTCAGAAGTACAACATGCGGCTACTATGGCTCCCCGCATGGATGTTCCATTGGACATAGG
CACATTTCCACGTTTGACTACTGTCCCTATAATGACAAATGATCAGCATGAACTTTTCAGTAAGTTCTTGAAATTGAAACCTCCGGTCTT
CAAGGGTGCTGAATCGGAGGATGCTTATGATTTTCTGGTTGACTGTCACGAGCTACTACACAAGATGGGTATAGTAGAACGGTTTGGTGT
GGAGTTTGTGACTTATCAGTTTCAAGGGAACGCCCAAATGTGGTGGCGGTCACATATCGAGTGTCAACCAATAGAGGCATCACCTATGAC
TTGGGCCTCATTCTATAGTTTGTTTATGGAGAAGTATATCCCCCGGACTTTGAGGGATAAGAAAAGGGATGAGTTCTTGAGCCTAGAGCA
AGGTAGGGTGTCAGTTAATGCTTATGAGGCTAAGTTTcGTGCACTATCCAGATATGCCACTCAACTCTGTTTCAGTCCTCAAGAGCGGAT
TCGCCGGTXTTGTGAAGGGGTTGAGGTCAGAATTGCGGATTTCGTCCTTACAGGTAGCGGCAACGGCAAAATCCTTCCAAGAAGTGGTAG
ACTTTGTGATAGAAGTGGAAGGAGTGAAGCCAGACGACTTCACCACGACATCGACATCAAAGAGGTTTCGAAAGGGAGGTGAGTTTAAGG
GTTCTTACTCTAGAGGACAAGGTTCCGGAGGTTACTCAGCTCGACCCATTCAGTCTTCACTACAGACTGTAGTTGGGGGTCCACCTCAGA
CCGGTCAACACTTCTCCAAGGGGCCTATGAGTGACTCCAGAGAATGTTATGGATGTGGGGAGATTGGACATATTAGGATAAATTGTCCCG
GACCAAGTTATAGACCCCCAATAGCTAGAGGTAGAGGTGGTCATGGTAGAGGCCGTTATTCTGGAGGACGTGGTGGTCGAGGTAATGGTG
GTCACCAAAACGGCAGAGGTAATGGGCAAACTGGGGCCACTACATCACAACATGGTAGGGGCAATGGGCAGACAAACGATAGGGCCCATT
GTTACGCTTTCCCTGGGCGGTCTGAAGCGGAGGCATCTGATGCTGTCATCACAGGTAATCTTCTAGTTTGTGATTGCATGGCTTCCGTAT
TGTTTGATCCTGGATCCACGTTTTCTTATGTATCTTCCTCATTTGCTAATGGTCTAAATTTACATTGTGAATTTCTTGATATGCCTATTC
GT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan