ESTScan Details for Unigene SGN-U317065

Score 
280
Direction 
Reverse
Predicted Peptide Sequence 
DAVITGNLSIVIAWLLIVDPGIHFSXVSSSFANGLNLHCELLDMPIRVSTPVGESVVVEKVYRSCLVNFVGSNTYVDLVILEMVDFDVIL
GMTWLSPQFAILDCNAKTVTLAKPGTDPLVWEGDYTSNPVCIISFLRAKKMVSKGCLAFLAHLKDDTTQVPSIESVFIVCEFLDVFPADL
PGMPPDRDIDFCIDLEPGTRPISIPPYRMAPRRVKRVKGPTSRVVEQRFIRPSASPWGAPILFVKKKDGSFR
Predicted Coding Sequence 
GATGCTGTCATCACAGGTAATCTTTCGATTGTGATTGCATGGCTTCTTATTGTTGATCCTGGGATCCACTTTTCTANTGTATCTTCCTCA
TTTGCTAACGGTCTAAATTTACATTGTGAATTACTTGATATGCCTATTCGTGTTTCTACTCCGGTGGGTGAGTCTGTGGTAGTTGAAAAG
GTATATAGGTCTTGTTTGGTGAACTTTGTGGGGAGCAACACTTATGTAGATTTGGTTATCTTAGAAATGGTTGATTTTGATGTAATTCTG
GGTATGACTTGGCTTTCTCCGCAATTTGCGATCTTGGATTGTAATGCTAAAACGGTGACATTAGCCAAGCCTGGGACAGATCCGTTAGTG
TGGGAGGGTGACTACACTTCCAATCCGGTGTGCATCATCTCCTTTCTTCGTGCTAAGAAAATGGTTAGTAAAGGGTGTTTAGCTTTCTTG
GCACATCTCAAGGATGACACTACCCAAGTACCTTCGATTGAGTCGGTTTTTATAGTCTGTGAGTTTTTGGATGTGTTCCCTGCAGATCTT
CCTGGTATGCCACCAGATAGGGATATTGACTTCTGTATCGATCTTGAACCGGGCACACGCCCCATTTCTATACCCCCTTATAGAATGGCT
CCXCGTAGAGTTAAGAGAGTTAAAGGCCCAACTTCAAGAGTTGTTGAGCAAAGGTTTATTAGACCAAGTGCATCTCCTTGGGGTGCTCCG
ATTTTGTTTGTGAAGAAGAAGGATGGGAGTTTCCGX
Edits in Original Sequence 
(5')GATGCTGTCATCACAGGTAATCTTTCGATTGTGATTGCATGGCTTCTgTATTGTTGATCCTGGGATCCACgTTTTCTANTGTATCT
TCCTCATTTGCTAACGGTCTAAATTTACATTGTGAATTACTTGATATGCCTATTCGTGTTTCTACTCCGGTGGGTGAGTCTGTGGTAGTT
GAAAAGGTATATAGGTCTTGTTTGGTGAACTTTGTGGGGAGCAACACTTATGTAGATTTGGTTATCTTAGAAATGGTTGATTTTGATGTA
ATTCTGGGTATGACTTGGCTTTCTCCGCAATTTGCGATCTTGGATTGTAATGCTAAAACGGTGACATTAGCCAAGCCTGGGACAGATCCG
TTAGTGTGGGAGGGTGACTACACTTCCAATCCGGTGTGCATCATCTCCTTTCTTCGTGCTAAGAAAATGGTTAGTAAAGGGTGTTTAGCT
TTCTTGGCACATCTCAAGGATGACACTACCCAAGTACCTTCGATTGAGTCGGTTTTTATAGTCTGTGAGTTTTTGGATGTGTTCCCTGCA
GATCTTCCTGGTATGCCACCAGATAGGGATATTGACTTCTGTATCGATCTTGAACCGGGCACACGCCCCATTTCTATACCCCCTTATAGA
ATGGCTCCXCGTAGAGTTAAGAGAGTTAAAGGCCCAACTTCAAGAGTTGTTGAGCAAAGGTTTcATTAGACCAAGTGCATCTCCTTGGGG
TGCTCCGATTTTGTTTGTGAAGAAGAAGGATGGGAGTTTCCGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan