ESTScan Details for Unigene SGN-U317112

Score 
8
Direction 
Reverse
Predicted Peptide Sequence 
MNTDLNLISNINDKGIRNRFNRYPVITTTDLEAGDVGVG
Predicted Coding Sequence 
ATGAATACTGACCTGAATTTGATCTCCAATATTAACGATAAAGGCATTAGGAATCGGTTTAACCGTTATCCAGTCATCACCACGACGGAC
TTGGAGGCCGGGGACGTCGGTGTCGGX
Edits in Original Sequence 
TTTTTTTTTTGAATTTGACAAAACATTTGAAAATAACATAGGAAAATGACAACACATATTGTACTAGTACATCATATAGGGACATAGGGT
ATTTACTGTGTTATGTTTTACCAATTGGAATTTATACGCAGTAAAACTTCCTTAAGTACCATATACTTACTATATAGAACATATAAAGGT
AATTTAATTATCTTTATAATTGGATTATTTCTCGTTTTGTGCGTGTCGGGGTCATGCTAAAGGACATTTATCTCGGCGATTTTAGTGATT
CAACTTGAGATTTTCCTCTAGGTCCGTTTGTTCTAATGAAAGCTCGATACTCGTTGAACGTCGTCGGTAAATATAACGCCGGCTGATCCT
CCGTCACAAGTTCTTCAGCAGGTTGAATAAGGATGTCACCTCCTGGATTGTAGAAAAATGCTAAAGAGACACGTTCTTGCCCTGAATTAA
CGATCACGCGATGCTCTATGCTTTTGTATATTGCATTGCTTAGTACCTAATACATGCAATAATTGCAAAAAAAAATAAAAATTCACTATC
AATATACAAGTTATCGTTATTATTGACGAGATTACTAGACGTT
(5')ATGAATACTGACCTGAATTTGATCTCCAATATTAACGATAAAG
GCATTAGGAATCGGTTTAACCGTTATCCAGTCATCACCACGACGGACTTGGAGGCCGGGGACGTCGGTGTCGGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan