ESTScan Details for Unigene SGN-U317120

Score 
1276
Direction 
Forward
Predicted Peptide Sequence 
MLDYGSKSQDXGWAAKKKFVRLDGFDCGLTSAVNTVAANKCGFIMEALRHSGHATSSPSRSFKRGMRKGSEGLKSIGRSLGFGVSKAVFP
EDLKVSEKKIFDPQDKFLLLWNKLFVISCILAVSVDPLFFYLPVFDDKSNCLQIDRKLAVIATTLRTVVDAFYLIHMALQFRTAYIAPSS
RVFGRGELVIDPGQIAKRYLRSYFIIDLLAVVPLPQIVAXEIPAEMTGSDVLATKQALLYIILLQYIPRFVRVIPLTSELKRTTGVFAET
AWAGAASYLLLYMLASHIVGSFWYLLSVERYDTCWERACSHNTTCQTDFLYCGXQGMTGYNAWSNIRESVLNGACPRSGDNPPFDFGIFA
QALSSGIVFSMKFVTKYCYCLWWGLQNLSTLGQGLQTSTYPGESLFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVRRRDSEQWM
HHRLLPQELRERVRGYDQYKWQETRGVDEENIVQNLPKDLRRDIKRHLCLALVKRVPLFANMEERLLDAICEHLKPCLYIENTYLVREGD
PVDEMLFVIRGRLESVTTDGGRSGFFNRSLLKESDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRKLHSR
QVTAHVPFLLTALENLGCLLHPSSMEAFHEKETYGTTKKEDEEAEALAGASSNSGGASFSIGATFLASRFAANALRGVHKNRNLKSAREL
MKLQKPPEPDFSEDTD
Predicted Coding Sequence 
ATGTTAGATTATGGTTCGAAGTCCCAAGATXCTGGATGGGCAGCAAAAAAAAAGTTTGTAAGGTTGGATGGCTTTGATTGCGGACTAACC
TCAGCXGTCAACACCGTAGCTGCAAATAAATGTGGCTTCATCATGGAAGCTTTAAGACATTCTGGCCATGCAACTAGCAGCCCGTCAAGG
TCTTTTAAGAGAGGAATGAGAAAAGGATCTGAAGGACTAAAGTCGATTGGTCGATCACTTGGATTTGGTGTCTCTAAGGCAGTATTTCCT
GAAGATCTGAAAGTTTCAGAGAAGAAGATTTTTGATCCTCAAGATAAATTCCTTCTCTTGTGGAATAAGCTGTTTGTTATATCATGCATT
CTGGCCGTGTCTGTTGATCCGTTGTTTTTCTACCTTCCAGTTTTCGATGACAAGTCAAATTGCCTTCAGATTGATCGAAAGCTAGCTGTG
ATAGCCACAACTCTTCGTACCGTTGTCGATGCTTTCTATCTTATTCACATGGCACTTCAGTTTCGTACAGCTTATATTGCACCATCCTCT
CGAGTTTTTGGAAGGGGTGAACTAGTGATAGATCCTGGACAGATTGCTAAAAGATACTTGCGATCCTATTTTATCATCGATCTTCTTGCT
GTGGTTCCCTTGCCTCAGATTGTAGCTGXGGAGATTCCTGCAGAGATGACAGGTTCTGATGTTCTGGCTACCAAACAAGCTTTGCTCTAT
ATCATTTTGCTCCAGTATATCCCCAGATTTGTCCGAGTTATACCCTTAACGTCAGAATTGAAAAGAACTACTGGTGTCTTCGCTGAAACT
GCATGGGCTGGTGCTGCATCCTATTTGCTGTTGTACATGCTTGCTAGTCACATAGTTGGCTCGTTCTGGTATTTGCTTTCTGTGGAACGC
TATGATACATGCTGGGAAAGAGCTTGTAGTCATAACACAACATGCCAAACTGATTTCTTGTACTGCGGCXATCAAGGCATGACAGGGTAT
AATGCTTGGAGCAATATCAGAGAATCGGTTTTAAATGGAGCATGCCCTCGTAGCGGTGACAATCCACCATTTGATTTTGGAATTTTCGCG
CAGGCTTTGTCATCAGGCATAGTTTTCTCAATGAAGTTTGTGACTAAATATTGCTACTGTTTGTGGTGGGGACTCCAGAATTTAAGTACC
CTTGGACAGGGACTTCAAACTAGCACATATCCTGGGGAGTCTTTATTCTCTATTGCACTAGCGATACTCGGGCTCATTCTCTTTGCATTG
CTGATTGGTAACATGCAGACATACCTTCAGTCACTTACTATTCGACTTGAAGAGATGAGAGTTAGAAGGCGTGACTCGGAACAATGGATG
CATCACAGATTGCTTCCACAAGAACTTCGAGAACGGGTAAGGGGCTATGATCAGTACAAGTGGCAAGAAACACGTGGAGTGGATGAAGAA
AATATAGTTCAGAATTTGCCCAAGGATCTCAGGAGGGATATCAAACGTCATCTTTGTCTGGCTCTAGTGAAGAGGGTGCCTCTATTTGCA
AATATGGAGGAGAGATTGCTTGATGCAATTTGTGAGCATCTAAAACCTTGTTTGTACATCGAGAACACTTACCTTGTTCGAGAAGGAGAT
CCAGTGGATGAAATGCTCTTTGTGATACGAGGGCGCCTTGAGAGTGTGACAACTGATGGTGGGAGAAGCGGTTTCTTCAACCGCAGCTTG
TTAAAAGAATCCGACTTCTGTGGAGAAGAACTTCTTACTTGGGCACTAGACCCGAAATCAGGTTCTAACCTCCCATCTTCTACTCGTACC
GTGAAAGCTCTGACAGAGGTAGAGGCTTTTGCATTAATAGCAGATGAGTTGAAATTCGTCGCCAGTCAGTTCAGAAAGCTCCACAGTAGA
CAGGTXACAGCACACGTTCCGTTTCTACTCACAGCACTGGAGAACTTGGGCTGCTTGCTTCATCCAAGCAGCATGGAGGCGTTTCACGAA
AAGGAAACTTATGGAACTACAAAGAAAGAGGATGAAGAAGCAGAAGCGTTGGCCGGGGCCAGTAGTAACTCGGGTGGAGCTTCTTTTAGT
ATTGGGGCAACGTTCTTGGCATCGAGATTTGCAGCTAATGCTCTCCGAGGCGTTCATAAGAATCGAAATCTCAAGTCTGCTAGGGAGCTT
ATGAAGCTGCAAAAACCTCCAGAACCTGATTTCAGTGAAGATACTGACTGA
Edits in Original Sequence 
CCACCCCCACCCCCAACTTCCTTCTTCCCCTCTTGTCTGTTCATTAGCACCATAGTTCATGGATTAACCTCAAAGACTTCAATTTTACTA
TATATGTGTTTGATTGTACAAA
(5')ATGTTAGATTATGGTTCGAAGTCCCAAGATXCTGGATGGGCAGCAAAAAAAAAGTTTGTAAGGT
TGGATGGCTTTGATTGCGGACTAACCTCAGCXGTCAACACCGTAGCTGCAAATAAATGTGGCTTCATCATGGAAGCTTTAAGACATTCTG
GCCATGCAACTAGCAGCCCGTCAAGGTCTTTTAAGAGAGGAATGAGAAAAGGATCTGAAGGACTAAAGTCGATTGGTCGATCACTTGGAT
TTGGTGTCTCTAAGGCAGTATTTCCTGAAGATCTGAAAGTTTCAGAGAAGAAGATTTTTGATCCTCAAGATAAATTCCTTCTCTTGTGGA
ATAAGCTGTTTGTTATATCATGCATTCTGGCCGTGTCTGTTGATCCGTTGTTTTTCTACCTTCCAGTTTTCGATGACAAGTCAAATTGCC
TTCAGATTGATCGAAAGCTAGCTGTGATAGCCACAACTCTTCGTACCGTTGTCGATGCTTTCTATCTTATTCACATGGCACTTCAGTTTC
GTACAGCTTATATTGCACCATCCTCTCGAGTTTTTGGAAGGGGTGAACTAGTGATAGATCCTGGACAGATTGCTAAAAGATACTTGCGAT
CCTATTTTATCATCGATCTTCTTGCTGTGGTTCCCTTGCCTCAGATTGTAGCTGXGGAGATTCCTGCAGAGATcGACAGGTTCTGATGTT
CTGGCTACCAAACAAGCTTTGCTCTATATCATTTTGCTCCAGTATATCCCCAGATTTGTCCGAGTTATACCCTTAACGTCAGAATTGAAA
AGAACTACTGGTGTCTTCGCTGAAACTGCATGGGCTGGTGCTGCATCCTATTTGCTGTTGTACATGCTTGCTAGTCACATAGTTGGCTCG
TTCTGGTATTTGCTTTCTGTGGAACGCTATGATACATGCTGGGAAAGAGCTTGTAGTCATAACACAACATGCCAAACTGATTTCTTGTAC
TGCGGCXATCAAGGCATGACAGGGTATAATGCTTGGAGCAATATCAGAGAATCGGTTTTAAATGGAGCATGCCCTCGTAGCGGTGACAAT
CCACCATTTGATTTTGGAATTTTCGCGCAGGCTTTGTCATCAGGCATAGTTTTCTCAATGAAGTTTGTGACTAAATATTGCTACTGTTTG
TGGTGGGGACTCCAGAATTTAAGTACCCTTGGACAGGGACTTCAAACTAGCACATATCCTGGGGAGTCTTTATTCTCTATTGCACTAGCG
ATACTCGGGCTCATTCTCTTTGCATTGCTGATTGGTAACATGCAGACATACCTTCAGTCACTTACTATTCGACTTGAAGAGATGAGAGTT
AGAAGGCGTGACTCGGAACAATGGATGCATCACAGATTGCTTCCACAAGAACTTCGAGAACGGGTAAGGGGCTATGATCAGTACAAGTGG
CAAGAAACACGTGGAGTGGATGAAGAAAATATAGTTCAGAATTTGCCCAAGGATCTCAGGAGGGATATCAAACGTCATCTTTGTCTGGCT
CTAGTGAAGAGGGTGCCTCTATTTGCAAATATGGAGGAGAGATTGCTTGATGCAATTTGTGAGCATCTAAAACCTTGTTTGTACATCGAG
AACACTTACCTTGTTCGAGAAGGAGATCCAGTGGATGAAATGCTCTTTGTGATACGAGGGCGCCTTGAGAGTGTGACAACTGATGGTGGG
AGAAGCGGTTTCTTCAACCGCAGCTTGTTAAAAGAATCCGACTTCTGTGGAGAAGAACTTCTTACTTGGGCACTAGACCCGAAATCAGGT
TCTAACCTCCCATCTTCTACTCGTACCGTGAAAGCTCTGACAGAGGTAGAGGCTTTTGCATTAATAGCAGATGAGTTGAAATTCGTCGCC
AGTCAGTTCAGAAAGCTCCACAGTAGACAGGTXACAGCACACGTTCCGTTTCTACTCACAGCACTGGAGAACTTGGGCTGCTTGCTTCAT
CCAAGCAGCATGGAGGCGTTTCACGAAAAGGAAACTTATGGAACTACAAAGaAAAGAGGATGAAGAAGCAGAAGCGTTGGCCGGGGCCAG
TAGTAACTCGGGTGGAGCTTCTTTTAGTATTGGGGCAACGTTCTTGGCATCGAGATTTGCAGCTAATGCTCTCCGAGGCGTTCATAAGAA
TCGAAATCTCAAGTCTGCTAGGGAGCTTATGAAGCTGCAAAAACCTCCAGAACCTGATTTCAGTGAAGATACTGACTGA(3')ATTTTGT
ATGCTTAAGCTTTGCAAAAAGCTTGATGTATAATTTATGTTTATTAGTCTTATTGCTACATATTTATGTAAGAGTTTAACTTCTTTAAAC
TGATACTGATTGTGTAAATAAATATTTACATTTATCATCTCGCCTAAAAGGTAACTATGGGTAGCTGCCCGTGATAAGTAGAAGACACCT
TTCGTTTCAATTTATTTGTCTGTTTTAAATTGATACAACGTTTGTAAAAAAGATTTTTAAATTTTGTGGTATTAAACTAAAGATACGTAA
AATGTATCATAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan