ESTScan Details for Unigene SGN-U317122

Score 
868
Direction 
Forward
Predicted Peptide Sequence 
MGYVKLVFLMLFSLLCQLAFCSSSSHLCPKDQALALLQFKQMFKISRYVSGNCFDEKANRFSHIRKLFRGTRAQIVALGMEFIXDETTGK
VIELNLTCSKLQGKFHSNSSVFQLSNLKRLDLSNNNFSGSYISPKFGEFSSLTHLHLSYSSFIGRIPVEISRLSELQVLHIRGYSYELRF
EPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSHLTNLRLRNTQLYGMLPESVFHLSNLESLYLLENPQLTVGFPTPNGIAAHHSWSY
XLYRVNATGGIPESFGHLTSLRTLIIHSCNLSGSIPKPLWNLTNIEVLILGDNHLEGTISDLFRLGKLRSLSLAYNNFDANLSSYPITEA
GXQLKALDFSFNSITGSIPSNVSGXAKPKFTQIVIKPVEWDYTILDILPPFTIAVRLDDNHFSGNIQEFKSKILLFVSVKQNQLQGPIPK
SLQNHRNLYSLFLSHNNLSGQIPSTICNLKTLEVLDLGSNNFEGTVPLCLGEMSGLWLLDLSNNRLRGTIDTTFSIGNQLIVIKFNKNKL
EGKVPQSLINCTVLEVVDLGNNELNDTFPKWLGALSELQILNLRSNKFFGPIKVSRTDNLFAQIRIIDLSSNGFSGHLPVSLFKKFEVMK
ITSENSGTREYVGDIFYYYTYSLIVTTKGLELELPRVLTTEIIINLSRNRFEGNIPSIIGDLIALRTLNLSHNRLEGHIPASLHQLSVLE
SLDLSSNKISGEIPQQLVSLKSLEVLNLSHNHLVGCIPKGEQFDTFENSSYQGNDGLRGFPLSKDCGVDEGVPEATTPFELDEEEDSPMI
SWQAVLMGYGCGLVIGLSIIYIMLSTQYPAWFSRMDVKLEHKILTRMKRHKKRH
Predicted Coding Sequence 
ATGGGTTACGTAAAACTTGTTTTTTTAATGCTATTTTCCTTACTCTGTCAACTTGCTTTCTGCTCGTCCTCATCTCATTTGTGCCCCAAA
GATCAAGCTCTTGCTCTTCTACAATTCAAGCAAATGTTTAAAATAAGTCGTTATGTTTCCGGTAACTGTTTCGACGAAAAGGCCAACCGA
TTCAGTCATATCCGCAAACTCTTTCGTGGAACAAGAGCACAGATTGTTGCTCTTGGGATGGAGTTTATTGXTGACGAGACGACTGGAAAA
GTGATTGAGCTTAACCTCACTTGCAGCAAACTTCAAGGCAAATTTCACTCAAACAGTAGTGTCTTTCAACTCTCCAATCTCAAAAGGCTT
GATTTGTCTAATAATAATTTCTCTGGATCGTACATTTCGCCTAAATTTGGTGAGTTTTCTAGTTTGACGCATCTTCATTTGTCGTATTCG
AGTTTTATAGGTCGAATCCCAGTAGAAATCTCTCGTCTTTCGGAATTACAAGTTCTTCATATCCGGGGTTATTCGTATGAGCTTAGATTC
GAACCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCGATTAAGAGAGCTCCACCTTAGCGATGTAAACATCTCTTCCGCTATTCCT
CTGAATTTCTCTTCTCATTTAACAAATCTAAGACTTCGGAACACGCAGTTATACGGGATGCTGCCGGAAAGTGTTTTTCACCTTTCCAAC
TTAGAATCTCTTTATTTGTTAGAAAATCCCCAGCTCACTGTTGGTTTCCCAACACCAAATGGAATAGCAGCACATCACTCATGGAGTTAT
XATCTCTATAGAGTGAATGCTACAGGCGGGATACCTGAATCATTTGGTCATCTAACTTCACTGCGTACATTGATAATACATTCTTGTAAT
CTCTCAGGTTCTATTCCTAAACCTCTATGGAATCTCACCAATATAGAGGTATTGATTCTGGGTGATAACCATCTTGAAGGAACAATTTCT
GATTTATTTAGATTAGGAAAACTCAGGTCGTTATCACTTGCATATAACAACTTTGATGCCAACTTGAGTTCTTATCCTATAACAGAAGCT
GGAXCACAACTTAAAGCTTTAGATTTTTCATTCAATTCCATAACAGGCTCAATTCCTTCTAATGTAAGTGGTXCTGCAAAACCTAAATTC
ACTCAGATTGTCATCAAACCAGTTGAATGGGACTATACCATCCTGGATATTCTCCCTCCCTTCACTATCGCAGTTAGACTTGATGATAAC
CATTTCAGTGGAAACATTCAGGAGTTCAAGTCTAAAATATTGTTATTTGTTTCTGTAAAACAAAATCAGCTGCAAGGTCCTATTCCAAAG
TCACTCCAAAACCATCGTAATCTATATTCTCTTTTCCTTTCGCACAATAATCTCAGTGGACAGATTCCTTCAACCATCTGCAATCTGAAA
ACACTAGAAGTGCTAGATTTGGGGAGCAATAATTTCGAGGGAACAGTCCCTCTATGTTTGGGTGAGATGAGTGGTCTTTGGTTATTGGAT
TTAAGCAACAATCGTCTTAGGGGGACAATTGATACTACTTTTAGTATAGGAAACCAACTTATAGTTATTAAATTTAATAAGAATAAGCTA
GAGGGGAAAGTCCCGCAATCTTTGATCAATTGCACGGTTTTGGAAGTTGTTGATTTAGGTAACAATGAGTTGAATGACACGTTTCCTAAA
TGGTTGGGAGCTCTATCTGAGTTGCAGATTTTGAACTTGAGGTCAAATAAGTTCTTTGGCCCTATAAAAGTTTCTAGGACTGACAACTTA
TTTGCTCAAATTCGAATCATAGATCTCTCATCTAACGGATTTAGTGGACATTTACCCGTGAGCCTTTTCAAGAAATTTGAAGTCATGAAA
ATAACTAGTGAAAACAGTGGAACCCGAGAGTATGTAGGAGATATTTTTTATTATTACACATATTCCTTGATAGTGACAACAAAGGGACTG
GAGCTTGAACTTCCTCGAGTTTTGACTACAGAGATTATTATCAATCTCTCAAGGAATAGATTTGAAGGTAATATCCCAAGCATTATTGGA
GATCTCATTGCGCTTCGTACTTTGAACTTGTCTCACAATCGCTTGGAAGGTCACATACCAGCATCACTGCACCAGTTATCTGTACTTGAA
TCATTGGATCTCTCATCCAACAAAATCAGCGGAGAAATTCCACAACAGCTGGTATCCCTCAAATCACTTGAAGTCTTAAATCTCTCTCAC
AATCATCTTGTTGGATGCATCCCCAAAGGAGAACAATTTGATACGTTTGAGAATAGTTCATACCAAGGGAATGATGGGTTACGTGGATTT
CCACTCTCAAAAGATTGTGGCGTCGATGAAGGGGTACCAGAAGCAACAACTCCATTTGAGCTAGATGAAGAAGAAGATTCACCAATGATC
AGTTGGCAGGCGGTTCTCATGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCATAATATACATAATGCTGTCAACTCAATATCCAGCA
TGGTTTTCGAGGATGGATGTAAAATTGGAACACAAAATTCTTACGAGGATGAAAAGGCACAAGAAAAGACATTAG
Edits in Original Sequence 
ATTTTTGATTTCTTATCTACCAACTTAATTAGTTTTGAACATTTTTAGTGCAGAA(5')ATGGGTTACGTAAAACTTGTTTTTTTAATGC
TATTTTCCTTACTCTGTCAACTTGCTTTCTGCTCGTCCTCATCTCATTTGTGCCCCAAAGATCAAGCTCTTGCTCTTCTACAATTCAAGC
AAATGTTTAAAATAAGTCGTTATGTTTCCGGTAACTGTTTCGACGtAAAAGGCCAACCGATTCAGTCATATCCGCAAACTCTTTCGTGGA
ACAAGAGCACAGATTGTTGCTCTTGGGATGGAGTTTATTGXTGACGAGACGACTGGAAAAGTGATTGAGCTTAACCTCACTTGCAGCAAA
CTTCAAGGCAAATTTCACTCAAACAGTAGTGTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTAATAATAATTTCTCTGGATCG
TACATTTCGCCTAAATTTGGTGAGTTTTCTAGTTTGACGCATCTTCATTTGTCGTATTCGAGTTTTATAGGTCGAATCCCAGTAGAAATC
TCTCGTCTTTCGGAATTACAAGTTCTTCATATCCGGGGTTATTCGTATGAGCTTAGATTCGAACCTCACAATTTTGAACTGCTCCTTAAG
AACTTGACCCGATTAAGAGAGCTCCACCTTAGCGATGTAAACATCTCTTCCGCTATTCCTCTGAATTTCTCTTCTCATTTAACAAATCTA
AGACTTCGGAACACGCAGTTATACGGGATGCTGCCGGAAAGTGTTTTTCACCTTTCCAACTTAGAATCTCTTTATTTGTTAGAAAATCCC
CAGCTCACTGTTaGGTTTCCCAACACCAAATGGAATAGCAGCACATCACTCATGGAGTTATXATCTCTATAGAGTGAATGCTACAGGCGG
GATACCTGAATCATTTGGTCATCTAACTTCACTGCGTACATTGATAATACATTCTTGTAATCTCTCAGGTTCTATTCCTAAACCTCTATG
GAATCTCACCAATATAGAGGTATTGATTCTGGGTGATAACCATCTTGAAGGAACAATTTCTGATTTATTTAGATTAGGAAAACTCAGGTC
GTTATCACTTGCATATAACAACTTTGATgGCCAACTTGAGTTCTTATCCTATAACAGAAGCTGGAXCACAACTTAAAGCTTTAGATTTTT
CATTCAATTCCATAACAGGCTCAATTCCTTCTAATGTAAGTGGTXCTGCAAAACCTAAATTCACTCAGATTGTCATCAAACCAGTTGAAT
GGGACTATACCATCCTGGATATTCTCCCTCCCTTCACTATCGCAGTTAGACTTGAgTGATAACCATTTCAGTGGAAACATTCAGGAGTTC
AAGTCTAAAATATTGTTATTTGTTTCTGTAAAACAAAATCAGCTGCAAGGTCCTATTCCAAAGTCACTCCAAAACCATCGTAATCTATAT
TCTCTTTTCCTTTCGCACAATAATCTCAGTGGACAGATTCCTTCAACCATCTGCAATCTGAAAACACTAGAAGTGCTAGATTTGGGGAGC
AATAATTTCGAGGGAACAGTCCCTCTATGTTTGGGTGAGATGAGTGGTCTTTGGTTATTGGATTTAAGCAACAATCGTCTTAGGGGGACA
ATTGATACTACTTTTAGTATAGGAAACCAACTTATAGTTATTAAATTTAATAAGAATAAGCTAGAGGGGAAAGTCCCGCAATCTTTGATC
AATTGCACGGTTTTGGAAGTTGTTGATTTAGGTAACAATGAGTTGAATGACACGTTTCCTAAATGGTTGGGAGCTCTATCTGAGTTGCAG
ATTTTGAACTTGAGGTCAAATAAGTTCTTTGGCCCTATAAAAGTTTCTAGGACTGACAACTTATTTGCTCAAATTCGAATCATAGATCTC
TCATCTAACGGATTTAGTGGACATTTACCCGTGAGCCTTTTCAAGAAATTTGAAGTCATGAAAATAACTAGTGAAAACAGTGGAACCCGA
GAGTATGTAGGAGATATTTTTTATTATTACACATATTCCTTGATAGTGACAACAAAGGGACTGGAGCTTGAACTTCCTCGAGTTTTGACT
ACAGAGATTATTATCAATCTCTCAAGGAATAGATTTGAAGGTAATATCCCAAGCATTATTGGAGATCTCATTGCGCTTCGTACTTTGAAC
TTGTCTCACAATCGCTTGGAAGGTCACATACCAGCATCACTGCACCAGTTATCTGTACTTGAATCATTGGATCTCTCATCCAACAAAATC
AGCGGAGAAATTCCACAACAGCTGGTATCCCTCAAATCACTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAA
GGAGAACAATTTGATACGTTTGAGAATAGTTCATACCAAGGGAATGATGGGTTACGTGGATTTCCACTCTCAAAAGATTGTGGCGTCGAT
GAAGGGGTACCAGAAGCAACAACTCCATTTGAGCTAGATGAAGAAGAAGATTCACCAATGATCAGTTGGCAGGCGGTTCTCATGGGTTAC
GGTTGTGGACTTGTTATTGGACTGTCCATAATATACATAATGCTGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATGTAAAATTG
GAACACAAAATTCTTACGAGGATGAAAAGGCACAAGAAAAGACATTAG(3')TGTGTAACCTCTAGGATTCAAGTCTACTGCATTGCTGG
GATGTGAACAAAAGTTTCTACTTTCATAGTTAGTGTTTGTGTTTGTTACATTTTCTTCTGTTGTGACTCAACAAATTCAATTGCAAGGAA
AAACCATAGAATTTCATAGAATGCAAAGGCAATAGAAAGAACATTAAAAATAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan