ESTScan Details for Unigene SGN-U317278

Score 
215
Direction 
Forward
Predicted Peptide Sequence 
MASAYKLVVLLIVSIGIVIANGDDDKSLGDKCGTEFQKVAACLTYATGKAPSPSKECCDAAEDIKDHDPVCLCYIIEQIHKGSSPQLKSM
GIQEEKLLQLPSACKLTNATISNCPS
Predicted Coding Sequence 
ATGGCAAGTGCATATAAGTTAGTAGTTTTACTAATAGTTTCTATTGGAATAGTAATAGCTAATGGTGATGATGATAAGAGCTTGGGCGAT
AAGTGTGGTACGGAGTTTCAAAAAGTGGCTGCATGTTTAACGTACGCGACGGGGAAGGCCCCGTCGCCATCGAAGGAATGTTGCGATGCG
GCGGAAGATATCAAAGATCATGACCCGGTTTGTTTGTGTTATATAATAGAACAGATCCATAAAGGATCAAGTCCTCAATTGAAGAGTATG
GGAATTCAAGAAGAAAAATTGCTTCAGCTTCCTTCTGCTTGCAAACTCACTAATGCTACCATCTCTAACTGTCCTAGT
Edits in Original Sequence 
TAAAAATAAA(5')ATGGCAAGTGCATATAAGTTAGTAGTTTTACTAATAGTTTCTATTGGAATAGTAATAGCTAATGGTGATGATGATA
AGAGCTTGGGCGATAAGTGTGGTACGGAGTTTCAAAAAGTGGCTGCATGTTTAACGTACGCGACGGGGAAGGCCCCGTCGCCATCGAAGG
AATGTTGCGATGCGGCGGAAGATATCAAAGATCATGACCCGGTTTGTTTGTGTTATATAATAGAACAGATCCATAAAGGATCAAGTCCTC
AATTGAAGAGTATGGGAATTCAAGAAGAAAAATTGCTTCAGCTTCCTTCTGCTTGCAAACTCACTAATGCTACCATCTCTAACTGTCCTA
GT(3')AAGTTCTTTTTTTAAAAAAAAATACTATATACTATAAGAAAAAAATATATGAGCTGCATGTTATGTGTAGAGAAAAATTAGTTA
TGTGACATAATTATTTTCATGTGACACGTACGTTCTTGGTCATGCCATACTATATATAGTCAATATTTGACTTATAAGGTATACATGCTG
TGAATTACTTTTTAACTTGGAATACGAGCGAAATACACGCTAAGTTTAGAATTGTTTTTAATATTTTATCCATTTTATAAAGAATGATCT
AGTTTAACTTGACACGAAGTTTAAGAAAATAAAAATGGTTTTTGATCATGTGGTTCTAAATAAAAATATATCAAATATACAAAATTGTTC
TTTAATCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan