ESTScan Details for Unigene SGN-U317356

Score 
1334
Direction 
Forward
Predicted Peptide Sequence 
MSARTVKVSNVSLSASEQDIKEFFSFSGDIEYVEMMSENERSQIAYVTFKDLQGAETAVLLSGATIIDQSVTIVPEPDYELPPTALVPIK
ATESANAAGGGSAIQKAEDVVSSMLAKGFILGKDAVNKAKTFDEKHQFTSTASAKVASLDQKIGLSEKINLGATIVNDKVKEMDQKFHVS
EKTKSALAAAEQTVSTAGSAIMKNRYVLTGASWVTGAFNKVTKAAGEVGQKTKEKMAEEQQAKNSAEGYVPIHALSESPKASKTEEPTKP
SSPKXINPLAYSNKFH
Predicted Coding Sequence 
ATGTCGGCTAGAACAGTGAAAGTGAGCAATGTTTCTCTGAGTGCATCGGAGCAAGATATCAAGGAGTTCTTTTCATTCTCCGGGGATATT
GAATATGTTGAGATGATGAGTGAGAATGAGCGATCTCAAATTGCATATGTCACATTCAAGGATCTCCAGGGTGCAGAAACTGCAGTTCTT
CTTTCTGGAGCAACAATTATTGATCAGTCGGTCACAATAGTACCTGAACCTGACTACGAGCTGCCTCCTACAGCTCTTGTGCCAATCAAG
GCAACTGAGAGTGCTAATGCAGCTGGTGGTGGATCTGCTATTCAAAAGGCAGAAGATGTTGTGAGCAGCATGTTAGCAAAGGGCTTCATC
CTGGGCAAGGATGCAGTTAACAAAGCCAAGACATTTGATGAGAAACACCAGTTCACATCCACTGCCTCTGCAAAAGTTGCTTCTTTAGAC
CAAAAGATTGGCCTTAGTGAGAAAATCAATTTGGGGGCAACGATTGTGAATGACAAAGTGAAAGAAATGGACCAGAAGTTCCATGTTTCT
GAAAAGACAAAATCTGCTCTTGCAGCTGCTGAGCAGACGGTTAGCACTGCTGGATCTGCCATCATGAAGAACAGATATGTGTTGACAGGG
GCATCTTGGGTTACTGGTGCTTTCAATAAGGTCACCAAGGCTGCAGGGGAAGTGGGCCAGAAGACGAAGGAAAAGATGGCAGAAGAACAA
CAGGCAAAAAATTCGGCTGAAGGTTATGTGCCTATACATGCTCTTTCAGAGTCCCCAAAAGCTTCCAAGACCGAGGAACCTACCAAGCCA
TCTTCACCTAAGGXGATTAATCCTCTAGCTTATTCAAACAAATTTCATTAA
Edits in Original Sequence 
TTTTTCCCATTTCTCTTCTCCCTCTCGCACGTCACTCGTTGACGTTTTTGAAGTACACCACTTTTTCCCTAAAACCCACAACCCTTCTTT
TCTCTTCTTCTACGTAACTCACATACGCTCAATTTCTACAAATATATTTGCTTCAAATAACTCTATTGTGGTTCTCTGATCTTCTTCTGA
TTCG
(5')ATGTCGGCTAGAACAGTGAAAGTGAGCAATGTTTCTCTGAGTGCATCGGAGCAAGATATCAAGGAGTTCTTTTCATTCTCCG
GGGATATTGAATATGTTGAGATGATGAGTGAGAATGAGCGATCTCAAATTGCATATGTCACATTCAAGGATCTCCAGGGTGCAGAAACTG
CAGTTCTTCTTTCTGGAGCAACAATTATTGATCAGTCGGTCACAATAGTACCTGAACCTGACTACGAGCTGCCTCCTACAGCTCTTGTGC
CAATCAAGGCAACTGAGAGTGCTAATGCAGCTGGTGGTGGATCTGCTATTCAAAAGGCAGAAGATGTTGTGAGCAGCATGTTAGCAAAGG
GCTTCATCCTGGGCAAGGATGCAGTTAACAAAGCCAAGACATTTGATGAGAAACACCAGTTCACATCCACTGCCTCTGCAAAAGTTGCTT
CTTTAGACCAAAAGATTGGCCTTAGTGAGAAAATCAATTTGGGGGCAACGATTGTGAATGACAAAGTGAAAGAAATGGACCAGAAGTTCC
ATGTTTCTGAAAAGACAAAATCTGCTCTTGCAGCTGCTGAGCAGACGGTTAGCACTGCTGGATCTGCCATCATGAAGAACAGATATGTGT
TGACAGGGGCATCTTGGGTTACTGGTGCTTTCAATAAGGTCACCAAGGCTGCAGGGGAAGTGGGCCAGAAGACGAAGGAAAAGATGGCAG
AAGAACAACAGGCAAAAAATTCGGCTGAAGGTTATGTGCCTATACATGCTCTTTCAGAGTCCCCAAAAGCTTCCAAGACCGAGGAACCTA
CCAAGCCATCTTCACCTAAGGXGATTAATCCTCTAGCTTATTCAAACAAATTTCATTAA(3')CTATTTTGCTATTTCGCTTCTCTCATC
TTTTAGCGGGTCATTGTGTTATGTTAGATACTTAGATATGCTAGTTATATATAAAACGTCCTGTAAGTTTGATGCATAGAACGATAGTTG
CTGAACCTTTGAATTCCTGTCAAATTCTCATCCTTATCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan