ESTScan Details for Unigene SGN-U317373

Score 
528
Direction 
Forward
Predicted Peptide Sequence 
MGLRLGLIFVDKVRVFKPKQVESVWNHNWXLIEKSFNVKYSDGVREALDELPDSFTITDPSISGHPIVYVSRGFLKVFGYSKNEVLGKNG
RVFQGPKTNRRSVMAIREAIREERGIQISLLNYRKDGTPFWMLFNMCPVYSEKDGEGGSFFGNSSAYFEEEKFTXVVELGEMEEYVMMEV
IAGGMSISVVGGRFARIXMMEMDRALSVDSVSGLDHTEVDVEGPCEASDQEKTKASVAVNNIMSVLANYSELNGDWSLTGDAVNRERVCS
VHP
Predicted Coding Sequence 
ATGGGATTGAGATTGGGGTTAATCTTTGTTGATAAAGTTAGAGTCTTTAAGCCAAAACAAGTTGAATCAGTATGGAATCACAACTGGGXT
TTAATTGAAAAATCATTTAATGTTAAATACTCAGATGGGGTTAGAGAAGCTCTTGATGAATTGCCTGATAGTTTTACAATTACTGATCCC
TCTATTTCTGGTCACCCTATTGTTTATGTATCAAGGGGTTTCTTGAAAGTATTTGGTTATTCAAAGAATGAGGTTTTAGGGAAGAATGGA
AGGGTATTTCAAGGGCCTAAGACTAATAGAAGATCAGTTATGGCGATTCGAGAGGCGATTCGTGAGGAGAGGGGTATACAGATTAGTTTG
TTGAATTATAGGAAGGATGGGACACCCTTTTGGATGTTGTTTAATATGTGTCCTGTTTATAGTGAGAAGGATGGXGAGGGTGGTTCATTT
TTTGGGAATTCAAGTGCCTATTTTGAGGAGGAGAAATTCACTAXGGTGGTGGAATTGGGAGAAATGGAGGAGTATGTTATGATGGAGGTA
ATTGCAGGGGGTATGTCTATAAGTGTTGTAGGAGGGAGGTTTGCTCGAATTCXGATGATGGAAATGGACAGAGCGTTATCGGTTGATTCA
GTTTCGGGGTTGGACCATACAGAAGTAGATGTTGAAGGACCTTGTGAAGCAAGTGATCAAGAGAAGACAAAAGCCAGTGTTGCTGTCAAC
AACATAATGTCCGTGTTGGCAAACTACAGTGAGTTGAATGGAGACTGGTCATTGACAGGAGATGCTGTCAATCGGGAACGAGTCTGCTCA
GTGCATCCTTAA
Edits in Original Sequence 
TTCATTCAATACCTTACAACTTAGATATTTTTCTCCATGTAAGCTCTTCAATATTGTTTTTATCGTAACTGATAAAATTATTGTTATATA
TGAGTCTTTTTTAGAAATATAAAATAAGATTGTGTTAGATTTGTTATATAGCGTGAAATGAATTAATGAGTTTCGTAAAAATGCAGGCAA
GACTGTGTTAGATTTAGAGTTTTAGTATATGGGGTTGTCTTTTCTTATGTGTGGTATGTTAAATTCTATGTGCTATTTCTATGGTTATTT
TTTTGTTTATTGATGATTTGTTTGTTCTTATTTTGTGTATTTTTCTGAAGCTGAAGTTCCCAATTATACTAGTTGACAC
(5')ATGGGAT
TGAGATTGGGGTTAATCTTTGTTGATAAAGTTAGAGTCTTTAAGCCAAAACAAGTTGAATCAGTATGGAATCACAACTGGGXTTTAATTG
AAAAATCATTTAATGTTAAATACTCAGATGGGGTTAGAGAAGCTCTTGATGAATTGCCTGATAGTTTTACAATTACTGATCCCTCTATTT
CTGGTCACCCTATTGTTTATGTATCAAGGGGTTTCTTGAAAGTATTTGGTTATTCAAAGAATGAGGTTTTAGGGAAGAATGGAAGGGTAT
TTCAAGGGCCTAAGACTAATAGAAGATCAGTTATGGCGATTCGAGAGGCGATTCGTGAGGAGAGGGGTATACAGATTAGTTTGTTGAATT
ATAGGAAGGATGGGACACCCTTTTGGATGTTGTTTAATATGTGTCCTGTTTATAGTGAGAAGGATGGXGAGGGTGGTTCATTTTTTGGGA
ATTCAAGTGCCTATTTTGAGGAGGAGAAATTCACTAXGGTGGTGGAATTGGGAGAAATGGAGGAGTATGTTATGATGGAGGTAATTGCAG
GGGGTATGTCTATAAGTGTTGTAGGAGGGAGGTTTGCTCGAATTCXGATGATGGAAATGGACAGAGCGTTATCGGTTGATTCAGTTTCGG
GGTTGGACCATACAGAAGTAGATGTTGAAGGACCTTGTGAAGCAAGTGATCAAGAGAAGACAAAAGCCAGTGTTGCTGTCAACAACATAA
TGTCCGTGTTGGCAAACTACAGTGAGTTGAATGGcAGACTGGTCATTGACAGGAGATGCTGTCAATCGGGAACGAGTCTGCTCAGTGCAT
CCTTAA(3')ATATATCTTTTGGTAGAATAAAACAAAGCTTTGTATTAACTGACGCACACTTACCAGACATGCCAATTGTCTATGCAAGT
GATGCCTTCCTAAAATTAATAGGCTACTTGAGACATGAAGTATTGGGTCGTAATTGCCGGTTTTTAAGTGGGGAAGATACAGAGAGAGGC
ACACAATTTCAGATAAAACAATGCATCCAAAATGAACAACCGTGTACTGTACATATCTTAAATTAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan