Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U317433

Score 
977
Direction 
Forward
Predicted Peptide Sequence 
MGDCLVVHTDRIVKANGAEIMDGKNPEMVGSSSAIAVDEKKVLEEEEEEEGDEEVPLIGRAECRICQEEDSLDKLESPCACSGSLKYTTE
HAFNTGANEKGDITCEICHQQYQPGYTVPPRPVAEETIIDIGGGWQISGTPLNLHDPRVLAIAEAERQLLEAEYDDYNSANASGAAFFRS
AALILMALLLLRHALPMTDTDGDDEDPTAFFSLFFSGQLAFFYPATSCSGPSASCSSADKXEEAAALAATQFAVVLHFGQPRSVQFTIAS
VAPATPAAPASVDNV
Predicted Coding Sequence 
ATGGGAGATTGTTTGGTGGTGCATACGGATCGTATTGTGAAGGCTAATGGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTAGGG
TCTTCGTCGGCAATAGCTGTAGATGAGAAGAAGGTGCTGGAGGAGGAGGAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGTAGA
GCAGAGTGCAGGATTTGCCAGGAGGAGGATTCTTTGGACAAGTTGGAGAGCCCATGTGCTTGCAGTGGAAGTCTCAAGTACACCACCGAG
CATGCGTTCAACACTGGTGCXAATGAGAAGGGGGATATTACTTGTGAGATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCTCCT
CGACCTGTGGCTGAGGAGACAATTATTGATATTGGGGGAGGATGGCAAATCTCTGGTACCCCTTTGAATTTACATGATCCTCGCGTCTTG
GCAATTGCAGAGGCTGAACGCCAACTTCTGGAAGCTGAATATGATGATTACAATTCTGCAAATGCAAGTGGTGCAGCTTTCTTTCGATCG
GCTGCTTTAATTTTGATGGCTCTTCTACTATTGCGCCATGCATTACCAATGACAGATACAGATGGAGATGATGAAGATCCAACTGCTTTC
TTTTCGCTTTTCTTCTCCGGGCAGTTGGCTTTCTTTTACCCTGCTACATCATGCTCTGGGCCATCAGCATCTTGCAGCAGCGCAGACAAA
GAXGAGGAAGCTGCAGCATTGGCAGCAACACAATTTGCAGTTGTGTTACACTTTGGACAGCCGAGAAGTGTACAGTTTACCATAGCTTCA
GTTGCACCAGCAACACCAGCAGCGCCTGCTTCAGTGGATAATGTTTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTAACAAGGAAGAAAGCTTAGACCAAAAAAGTGTAGAAAACAACAAACAAACCGCAATAGTTTGGTATTTTTTTCGGA
AAAATCTAAGATAAATACTATAATTTAGCAAACACCCTTCAATTTGTTCCGCTATAAATCCGCAGAAATTTTTGGGTTTTTTTCTTTCTC
TTTCCATTTGCTGAATTTCTTCATTTTCCCAGGAATTGTGTTACTTTTTTTATCTGGGTTTTTACA
(5')ATGGGAGATTGTTTGGTGGT
GCATACGGATCGTATTGTGAAGGCTAATGGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTAGGGTCTTCGTCGGCAATAGCTGT
AGATGAGAAGAAGGTGCTGGAGGAGGAGGAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGTAGAGCAGAGTGCAGGATTTGCCA
GGAGGAGGATTCTTTGGACAAGTTGGAGAGCCCATGTGCTTGCAGTGGAAGTCTCAAGTACACaCACCGAGCATGCGTTCAACACTGGTG
CXAATGAGAAGGGGGATATTACTTGTGAGATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCTCCTCGACCTGTGGCTGAGGAGA
CAATTATTGATATTGGGGGAGGATGGCAAATCTCTGGTACCCCTTTGAATTTACATGATCCTCGCGTCTTGGCAATTGCAGAGGCTGAAC
GCCAACTTCTGGAAGCTGAATATGATGATTACAATTCTGCAAATGCAAGTGGTGCAGCTTTCTTTCGATCGGCTGCTTTAATTTTGATGG
CTCTTCTACTATTGCGCCATGCATTACCAATGACAGATACAGATGGAGATGATGAAGATCCAACTGCTTTCTTTTCGCTTTTCTTaCTCC
GGGCAGTTGGCTTTCTTTTACCCTGCTACATCATGCTCTGGGCCATCAGCATCTTGCAGCAGCGCAGACAAAGAXGAGGAAGCTGCAGCA
TTGGCAGCAACACAATTTGCAGTTGTGTTACACTTTGGACAGCCGAGAAGTGTACAGTTTACCATAGCTTCAGTTGCACCAGCAACACCA
GCAGCGCCTGCTTCAGTGGATAATGTTTAA(3')ACAACAAGATGATCGTGCTTGATCTTTTATTTTGAAGCTAAATACTGCCTTATGCT
AGATTTGTTTGTCTGTTATCATATTTCATATATTATTATATGGGGAAGTTCGAAAATGAATTGTTGTATTACCATTTTGCCCCCCTTTAC
TGTTTTAAAAATTTGATTAAATATAAATATTTTTAATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan