ESTScan Details for Unigene SGN-U317471

Score 
450
Direction 
Forward
Predicted Peptide Sequence 
RPSNIIGDWKVGNCLKFHIRIGTSSELHRASAKSFIVAPSGLQQHQTLTRRKSAPPSTLNQAGASGSKRIVLKESSSESDLDLPFWQRTW
FIVLLLLMAISFFGLALFLFLTLDSDYISTTPVSAASEGVQITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVDDANSYWAV
RSTDSSKQGDPIKSGSIIRLQHIKTRRWLHSHLHASPISGNMEVSCFGDDKESDTGDYWRLEIEGSGKTWRQDQRIRLQHVDTGGYLHSH
DKKYTRIAGGQQEVCGVKEKRPDNVWLAAEGVYFPVTXKKQVKIVDNSMLAEFYL
Predicted Coding Sequence 
CGACCATCAAATATCATCGGAGATTGGAAAGTAGGAAATTGTTTGAAATTTCACATCCGAATCGGAACATCGTCGGAGCTCCATCGGGCA
TCCGCAAAGAGCTTCATCGTGGCTCCCTCAGGGTTACAACAACATCAAACTCTTACTAGAAGGAAATCAGCACCGCCGTCGACATTGAAT
CAAGCCGGTGCATCGGGCTCGAAGCGAATAGTGCTGAAAGAATCCTCATCCGAATCGGACCTTGATCTTCCATTTTGGCAAAGAACCTGG
TTCATTGTTCTCTTACTTCTCATGGCGATTTCCTTCTTCGGCCTAGCGCTTTTTCTTTTTCTCACCCTGGACTCTGATTACATATCAACA
ACACCTGTCTCCGCTGCTTCCGAAGGCGTCCAGATTACATATGGATCCGCGATTAAGTTGATGCACGAGAAGACAAAGTTTCGGTTGCAT
TCCCATGATGTGCCATATGGTTCTGGCAGTGGGCAGCAATCAGTCACTGGATTTCCCGGCGTAGATGATGCTAACAGCTACTGGGCTGTT
AGGAGCACCGACTCGTCCAAGCAAGGTGATCCTATAAAGAGTGGAAGCATCATCAGGCTGCAACATATAAAGACAAGAAGATGGTTACAT
AGCCATTTGCATGCTTCTCCCATATCAGGAAATATGGAGGTCAGCTGCTTCGGTGATGACAAGGAATCTGATACAGGGGACTATTGGAGA
CTTGAAATTGAGGGCAGTGGGAAAACTTGGAGGCAAGACCAAAGAATCAGGCTTCAACACGTGGACACTGGTGGTTATCTCCACAGTCAT
GACAAGAAATACACCCGAATTGCTGGAGGTCAGCAAGAGGTTTGCGGTGTTAAAGAAAAACGTCCAGATAATGTTTGGTTGGCAGCAGAG
GGTGTCTACTTCCCAGTTACTGAXAAAAAGCAAGTAAAGATTGTTGATAACAGTATGTTAGCTGAATTTTATCTGTAG
Edits in Original Sequence 
(5')CGACCATCAAATATCATCGGAGATTGGAAAGTAGGAAATTGTTTGAAATTTCACATCCGAATCGGAACATCGTCGGAGCTCCATCG
GGCATCCGCAAAGAGCTTCATCGTGGCTCCCTCAGGGTTACAACAACATCAAACTCTTACTAGAAGGAAATCAGCACCGCCGTCGACATT
GAATCAAGCCGGTGCATCGGGCTCGAAGCGAATAGTGCTGAAAGAATCCTCATCCGAATCGGACCTTGATCTTCCATTTTGGCAAAGAAC
CTGGTTCATTGTTCTCTTACTTCTCATGGCGATTTCCTTCTTCGGCCTAGCGCTTTTTCTTTTTCTCACCCTGGACTCTGATTACATATC
AACAACACCTGTCTCCGCTGCTTCCGAAGGCGTCCAGATTACATATGGATCCGCGATTAAGTTGATGCACGAGAAGACAAAGTTTCGGTT
GCATTCCCATGATGTGCCATATGGTTCTGGCAGTGGGCAGCAATCAGTCACTGGATTTCCCGGCGTAGATGATGCTAACAGCTACTGGGC
TGTTAGGAGCACCGACTCGTCCAAGCAAGGTGATCCTATAAAGAGTGGAAGCATCATCAGGCTGCAACATATAAAGACAAGAAGATGGTT
ACATAGCCATTTGCATGCTTCTCCCATATCAGGAAATATGGAGGTCAGCTGCTTCGGTGATGACAAGGAATCTGATACAGGGGACTATTG
GAGACTTGAAATTGAGGGCAGTGGGAAAACTTGGAGGCAAGACCAAAGAATCAGGCTTCAACACGTGGACACTGGTGGTTATCTCCACAG
TCATGACAAGAAATACACCCGAATTGCTGGAGGTCAGCAAGAGGTTTGCGGTGTTAAAGAAAAACGTCCAGATAATGTTTGGTTGGCAGC
AGAGGGTGTCTACTTCCCAGTTACTGAXAAAAAGCAAGTAAAGATTGTTGATAACAGTATGTTAGCTGAATTTTATCTGTAG(3')AGAC
ATATTAGTTACTAATGTACCAAAACCTTTTCTAGTACTTTGAGCTGTTGTTAGCATTTTCACTGTTGCAAATGGTAACAATTGGTTGATA
ATTCTTCGCTGCTCGGTTTCCTTGTTACTTCCCTCAGGTGAGGATGATTCTGGTTCAATTATAAAGAAATAGTTAAAATGTTAGCCATTC
TTCTAATTTCATAGCACTTCTGAATCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan