ESTScan Details for Unigene SGN-U317589

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
MGSMFSSPQFSKEQMEAALTKAKQIVSSNPVVVFSKTYCGYCTRVKKLLSQLGATFKVIELDRESDGDEVQAALLEWTKQRTVPNVFIGG
EHVGGCDSVLEKHQQGKLLPMLKDAAAIPNNPAKXLELIYAPSSQPDNKNEVREFCNLTASSPLVGVV
Predicted Coding Sequence 
ATGGGATCAATGTTCAGTTCACCTCAGTTTAGCAAAGAACAAATGGAGGCCGCTCTTACCAAAGCCAAGCAGATCGTTTCCTCTAATCCT
GTTGTCGTATTCAGTAAAACATACTGCGGATATTGCACAAGGGTGAAGAAACTTCTTTCCCAGCTTGGTGCTACTTTTAAAGTTATTGAA
CTTGACCGGGAAAGTGATGGAGATGAGGTTCAAGCAGCATTACTAGAATGGACTAAGCAGAGGACTGTGCCTAACGTGTTTATTGGGGGA
GAACATGTTGGTGGCTGCGACAGCGTATTAGAGAAGCATCAACAGGGAAAGCTACTTCCCATGCTGAAGGACGCCGCTGCTATTCCCAAC
AATCCTGCCAAAGXTCTAGAACTCATCTATGCACCTAGTAGTCAACCTGACAATAAAAATGAAGTTAGAGAGTTCTGTAACTTAACTGCC
TCCTCTCCTCTAGTTGGGGTTGTTTAATAA
Edits in Original Sequence 
AGGATACGACTATCAAAGAAGATTTGACTTTTGAAAGTGCACAAAAAAATTAGGACGATGAATCTTAGCCAATTGGATTGTGAAAGTGCA
TAAAATAAACGCAATTGATGAGAATATGAGCCATCTCCCTTTTGTTGATTAAAAAGTCAATACAAGAGAGCAGAAGCCACCTGCAGAACC
CAGCTTCAAACACCTGTTAAGCTTATTCGGCCATCTTTGATTGTGTTAATAAAGGAAGGAGGCA
(5')ATGGGATCAATGTTCAGTTCAC
CTCAGTTTAGCAAAGAACAAATGGAGGCCGCTCTTACCAAAGCCAAGCAGATCGTTTCCTCTAATCCTGTTGTCGTATTCAGTAAAACAT
ACTGCGGATATTGCACAAGGGTGAAGAAACTTCTTTCCCAGCTTGGTGCTACTTTTAAAGTTATTGAACTTGACCGGGAAAGTGATGGAG
ATGAGGTTCAAGCAGCATTACTAGAATGGACTAAGCAGAGGACTGTGCCTAACGTGTTTATTGGGGGAGAACATGTTGGTGGCTGCGACA
GCGTATTAGAGAAGCATCAACAGGGAAAGCTACTTCCCATGCTGAAGGACGCCGCTGCTATTCCCAACAATCCTGCCAAAGXTCTAGAAC
TCATCTATGCACtCTAGTAGTCAACCTGACAATAAAAATGAAGTTAGAGAGTTCTGTAACTTAACTGCCTCCTCTCCTCTAGTTGGGGTT
GTTTAATAA(3')GACGCTGGATTTCAAGTTCCTTTTTCTGAACATTTTCTTTTAGTACTATTTTCTATTTTTTACTTGCCATCTGTTCC
TTTGGGAAGTATATATTGTAGATTCGCGTTACAGATGCAGTTCTGTTTCCGGCAAGAGTAAATTCGTCACTTCTGAATTTATTTCTTCCT
TTACAAATTCACAATGGAGAAGACGATCGGAACTTGCACACGAGCTAATTTAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan