Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U317699

Score 
776
Direction 
Forward
Predicted Peptide Sequence 
MAARVPLGCEPVVGSLTPSRKKEYRVTNRLQEGKRPLYGVVFNFIDSRYFNVFATVGGNRVTVYQCLEGGVIAVLQSYIDEDKDESFYTV
SWACNIDGSPFLVAGGINGVIRVIDAGKEKLHKSFVGHGDSVNEIRTQPLKPSLVLSASKDESVRLWNVHTGICILVFAGAGGHRNEVLS
VDFHPTDIYRIASCGMDNTVKIWSMKEFWTYVEKSFTWTDLPSKFPTKYVQFPLLIASVHNNYVDCNRWLGDFILSKSVDNEILLWEPKM
KEQSAGEGTSDVLQKYPVPECDIWFIKLSFDYHYKTAAIGNREGKIFVWEVQTSPPTLIAKLSHVQSKQPIRQTAMSFDGSTNLAVVKMG
LYGAGMW
Predicted Coding Sequence 
ATGGCGGCCAGAGTACCTCTAGGATGTGAGCCAGTTGTTGGATCATTAACACCGTCAAGGAAAAAGGAGTATAGAGTGACGAACAGACTC
CAAGAAGGCAAACGCCCATTATATGGCGTCGTCTTCAATTTCATTGATTCGCGCTACTTCAATGTCTTTGCTACTGTGGGCGGAAATCGT
GTGACTGTATATCAGTGTCTCGAAGGTGGTGTCATTGCTGTGCTGCAGTCTTATATTGATGAAGATAAAGATGAATCCTTTTACACTGTA
AGTTGGGCCTGCAATATTGATGGAAGTCCATTCTTAGTGGCTGGTGGAATAAATGGAGTTATTCGTGTTATTGATGCTGGGAAAGAGAAG
CTACACAAGAGCTTTGTGGGGCACGGAGACTCAGTAAATGAAATTAGGACTCAACCCTTGAAACCATCTCTTGTATTATCTGCCAGCAAA
GATGAATCTGTTCGCTTGTGGAATGTTCATACTGGAATATGCATTTTGGTATTTGCTGGCGCTGGAGGTCATCGGAATGAAGTACTTAGT
GTGGACTTCCATCCTACTGATATATATCGGATTGCTAGCTGTGGAATGGATAACACTGTTAAGATCTGGTCAATGAAAGAATTCTGGACA
TATGTGGAGAAATCGTTTACTTGGACGGATCTTCCTTCCAAGTTTCCCACAAAATATGTACAGTTTCCATTGTTAATAGCTTCTGTCCAT
AACAACTACGTTGACTGTAACAGATGGCTTGGTGATTTTATCTTGTCCAAGAGTGTTGACAATGAAATTCTATTATGGGAACCAAAGATG
AAAGAACAATCTGCTGGAGAGGGCACCAGTGACGTCCTCCAAAAGTATCCTGTGCCGGAGTGTGATATATGGTTTATTAAGCTTTCATTT
GATTATCACTACAAAACAGCAGCTATAGGAAATAGAGAAGGCAAGATCTTTGTCTGGGAAGTACAAACAAGCCCGCCAACTTTGATTGCA
AAGCTGTCTCATGTTCAATCTAAACAACCAATTAGACAGACTGCCATGTCTTTTGATGGAAGCACCAACTTAGCTGTTGTGAAGATGGGA
CTATATGGCGCTGGGATGTGG
Edits in Original Sequence 
AGTTTTTTTTTTAACAAATATTCCAAGGACACTGTAAATATGTAGAGTTTTTCGTTCCTCTCTAAGCTCTGGCGGAGTGATAGCA(5')A
TGGCGGCCAGAGTACCTCTAGGATGTGAGCCAGTTGTTGGATCATTAACACCGTCAAGGAAAAAGGAGTATAGAGTGACGAACAGACTCC
AAGAAGGCAAACGCCCATTATATGGCGTCGTCTTCAATTTCATTGATTCGCGCTACTTCAATGTCTTTGCTACTGTGGGCGGAAATCGTG
TGACTGTATATCAGTGTCTCGAAGGTGGTGTCATTGCTGTGCTGCAGTCTTATATTGATGAAGATAAAGATGAATCCTTTTACACTGTAA
GTTGGGCCTGCAATATTGATGGAAGTCCATTCTTAGTGGCTGGTGGAATAAATGGAGTTATTCGTGTTATTGATGCTGGGAAAGAGAAGC
TACACAAGAGCTTTGTGGGGCACGGAGACTCAGTAAATGAAATTAGGACTCAACCCTTGAAACCATCTCTTGTATTATCTGCCAGCAAAG
ATGAATCTGTTCGCTTGTGGAATGTTCATACTGGAATATGCATTTTGGTATTTGCTGGCGCTGGAGGTCATCGGAATGAAGTACTTAGTG
TGGACTTCCATCCTACTGATATATATCGGATTGCTAGCTGTGGAATGGATAACACTGTTAAGATCTGGTCAATGAAAGAATTCTGGACAT
ATGTGGAGAAATCGTTTACTTGGACGGATCTTCCTTCCAAGTTTCCCACAAAATATGTACAGTTTCCATTGTTAATAGCTTCTGTCCATA
ACAACTACGTTGACTGTAACAGATGGCTTGGTGATTTTATCTTGTCCAAGAGTGTTGACAATGAAATTCTATTATGGGAACCAAAGATGA
AAGAACAATCTGCTGGAGAGGGCACCAGTGACGTCCTCCAAAAGTATCCTGTGCCGGAGTGTGATATATGGTTTATTAAGCTTTCATTTG
ATTATCACTACAAAACAGCAGCTATAGGAAATAGAGAAGGCAAGATCTTTGTCTGGGAAGTACAAACAAGCCCGCCAACTTTGATTGCAA
AGCTGTCTCATGTTCAATCTAAACAACCAATTAGACAGACTGCCATGTCTTTTGATGGAAGCACCAtACTTAGCTGTTGTGAAGATGGGA
CTATATGGCGCTGGGATGTGG(3')TAGCAACAACTTTTTGAGTTTGAATGTACTATTATGAAGGATCGAAAGTATATCTAAACATGCAA
ACACACCTGTAAATTCTGCTTAACTTTATCTCTGACCTCTTTCTTGTGAGACTATCTCGATGTGCCAGTGAATCGAACTTGTACTATTAG
TGCTGGACATATGGAGGTCGATGATCTGGGAAGGTTGATAGGACGTCAAACTTGTCTAGTTATCGTTTTTAGCATTATTACTATGACTCC
CCTTTTATCTTGTTCTTCGTATTATTTCGATTGACAAAAATACCTTTGTAAAAGAAAGAAGGAAAAACAATCACTCTGTATTTGGGAGTT
TTCTTTTGCATAAGTTATTTTGGTTTGTACTTGAAAAAAAAAAAAAAAAAAACTCGAGACTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan