ESTScan Details for Unigene SGN-U317722

Score 
1075
Direction 
Forward
Predicted Peptide Sequence 
MSRKGLMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEEDRCPRP
MCYKAYGSAKEDSPMCDVPGFETCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIIL
QNKVDLVQENVAINQHEAIQKFIQGTVADGAPVVPISAQLKYNIDVVAEYIVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDDIRGGV
AGGSILKGVLKVNQLIEVRPGITVKDESGNIKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGEVGSLPEVF
VELEVNFFLLRRLLGVRTKDTERQGKVSKLAKGEILMLNIGSMSTGARVVAVKNVFPKLQLTSPVX
Predicted Coding Sequence 
ATGTCTCGGAAAGGATTGATGGAGCAAGACCTGAGTAAGTTGGATGTAACAAAGTTGCATCCACTTTCACCAGAGGTTATTTCTCGTCAG
GCTACGATAAATATTGGGACCATTGGGCATGTGGCTCATGGAAAGTCAACAGTTGTAAAAGCTATATCTGGAGTTCAGACTGTTCGTTTT
AAAAATGAGCTAGAAAGAAACATCACAATTAAGCTTGGGTATGCTAATGCTAAGATATATAAATGTGAAGAAGACCGCTGCCCTAGACCC
ATGTGCTACAAGGCATATGGAAGTGCAAAAGAAGACAGTCCCATGTGTGATGTCCCTGGTTTTGAGACCTGTAGGATGAAATTGCTGAGA
CATGTATCTTTCGTTGATTGCCCCGGTCATGATATTCTCATGGCTACTATGCTTAATGGAGCTGCAATTATGGATGGAGCATTACTTCTA
ATTGCTGCTAACGAGAGCTGTCCCCAACCTCAGACTTCTGAACATTTAGCTGCTGTAGAAATTATGCGCCTCCAACACATAATAATTCTC
CAAAATAAGGTTGATCTAGTTCAGGAAAATGTTGCCATTAACCAGCATGAGGCAATTCAGAAATTTATTCAGGGAACTGTTGCTGATGGT
GCTCCAGTTGTACCAATCTCTGCGCAATTGAAGTACAACATCGATGTTGTTGCTGAATATATTGTGAAGAAAATTCCCATTCCTGAGAGG
AATTTCATTTCACCACCAAATATGATAGTCATCCGATCATTTGATGTTAATAAACCTGGTTTTGAAGTTGATGATATCAGAGGCGGTGTC
GCTGGTGGCAGTATACTGAAGGGAGTCCTGAAGGTAAATCAACTCATTGAGGTTCGTCCCGGTATTACTGTCAAGGATGAGAGTGGCAAC
ATTAAGTGTACCCCAATATATTCAAGAATAGTGTCATTGTTTGCTGAGCAAAATGAGCTACAATTTGCTGTGCCCGGAGGCCTCATTGGA
GTTGGAACAACTATGGATCCAACATTGACTCGTGCTGATCGTTTGGTCGGACAGGTTCTTGGGGAGGTTGGCTCACTTCCTGAAGTGTTT
GTTGAACTGGAGGTAAATTTCTTCTTGCTCCGCCGTCTTCTGGGAGTGAGGACAAAGGACACGGAAAGGCAGGGTAAAGTCTCAAAGTTG
GCCAAGGGAGAGATTCTCATGTTAAACATAGGATCTATGTCAACTGGGGCTCGTGTTGTCGCTGTTAAGAATGTCTTCCCAAAACTGCAA
TTGACATCACCTGTGTXX
Edits in Original Sequence 
CTCTCTCGAGTGCAGCTGCGACGCCGCCGTTTCACTCTTCTCCGTTTCAGGCTTGAAATTCACGGACATCTGAAGAAGTATCAAAAAACA
GCTAAAAC
(5')ATGTCTCGGAAAGGATTGATGGAGCAAGACCTGAGTAAGTTGGATGTAACAAAGTTGCATCCACTTTCACCAGAGGTT
ATTTCTCGTCAGGCTACGATAAATATTGGGACCATTGGGCATGTGGCTCATGGAAAGTCAACAGTTGTAAAAGCTATATCTGGAGTTCAG
ACTGTTCGTTTTAAAAATGAGCTAGAAAGAAACATCACAATTAAGCTTGGGTATGCTAATGCTAAGATATATAAATGTGAAGAAGACCGC
TGCCCTAGACCCATGTGCTACAAGGCATATGGAAGTGCAAAAGAAGACAGTCCCATGTGTGATGTCCCTGGTTTTGAGACCTGTAGGATG
AAATTGCTGAGACATGTATCTTTCGTTGATTGCCCCGGTCATGATATTCTCATGGCTACTATGCTTAATGGAGCTGCAATTATGGATGGA
GCATTACTTCTAATTGCTGCTAACGAGAGCTGTCCCCAACCTCAGACTTCTGAACATTTAGCTGCTGTAGAAATTATGCGCCTCCAACAC
ATAATAATTCTCCAAAATAAGGTTGATCTAGTTCAGGAAAATGTTGCCATTAACCAGCATGAGGCAATTCAGAAATTTATTCAGGGAACT
GTTGCTGATGGTGCTCCAGTTGTACCAATCTCTGCGCAATTGAAGTACAACATCGATGTTGTTGCTGAATATATTGTGAAGAAAATTCCC
ATTCCTGAGAGGAATTTCATTTCACCACCAAATATGATAGTCATCCGATCATTTGATGTTAATAAACCTGGTTTTGAAGTTGATGATATC
AGAGGCGGTGTCGCTGGTGGCAGTATACTGAAGGGAGTCCTGAAGGTAAATCAACTCATTGAGGTTCGTCCCGGTATTACTGTCAAGGAT
GAGAGTGGCAACATTAAGTGTACCCCAATATATTCAAGAATAGTGTCATTGTTTGCTGAGCAAAATGAGCTACAATTTGCTGTGCCCGGA
GGCCTCATTGGAGTTGGAACAACTATGGATCCAACATTGACTCGTGCTGATCGTTTGGTCGGACAGGTTCTTGGGGAGGTTGGCTCACTT
CCTGAAGTGTTTGTTGAACTGGAGGTAAATTTCTTCTTGCTCCGCCGTCTTCTGGGAGTGAGGACAAAGGACACGGAAAGGCAGGGTAAA
GTCTCAAAGTTGGCCAAGGGAGAGATTCTCATGTTAAACATAGGATCTATGTCAACTGGGGCTCGTGTTGTCGCTGTTAAGAATGTCTTC
CCAAAACTGCAATTGACATCACCTGTGTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan