ESTScan Details for Unigene SGN-U317726

Score 
536
Direction 
Forward
Predicted Peptide Sequence 
MDMKGKKLTIIGTVDPVSVVSKLRKFWPAHIISVGPAKEPEKKEEPKKEEAKKEEAKKEGEGKKEDAPKEEGKKEEGKKEEEGKKDENKK
DEPKKDGEKKAEPQPQPQPMPMPMPFPHHQGYNQSVVGHGTLSAILS
Predicted Coding Sequence 
ATGGATATGAAAGGTAAGAAATTAACCATCATCGGAACAGTTGATCCAGTGAGTGTAGTGAGCAAACTTCGGAAATTTTGGCCAGCACAC
ATAATCTCAGTAGGACCAGCGAAAGAGCCAGAGAAGAAAGAGGAACCAAAGAAAGAAGAGGCCAAGAAAGAGGAGGCTAAGAAGGAGGGC
GAGGGCAAGAAAGAAGACGCTCCGAAGGAGGAAGGTAAGAAAGAGGAGGGTAAGAAGGAAGAAGAAGGTAAGAAGGATGAAAATAAGAAA
GACGAGCCCAAAAAGGACGGAGAGAAGAAGGCAGAACCACAGCCACAGCCACAGCCAATGCCGATGCCTATGCCATTCCCACATCATCAA
GGCTATAATCAATCCGTGGTTGGXCATGGTACCTTATCGGCCATACTATCX
Edits in Original Sequence 
AGCTTGATATTAAGCAAATAGTGTCATCTAACACCTCTTTGTCGAACAATTTAATTGATATGTATGTGAATAAAATTAAATGAACTAAGT
ATAGGCATACCGGTTTAACGACTACAAGTAATTCTTTTGATGTGAACACATATTTATCTTTAGCAAAAAGGGAAAGAATTTAGTTTGGGT
AATCAATTGAGTTGGTGGTGAGTCATTGTTAAAGGATTAGGAGGGTCTAATACTGAAGATGGTAGTTCTCCAACTTGGATTAGGTACTAA
GCCATTTAGTACCAATAGTCTCCAAATTGGATTCAACTTTCAACTAATTGAAATGAAAATGAGAAGTCAATTTTTACATCGATTGTGATG
TGGCGCCACGTCAAGTGGGGTCCACTTCATGTAAGCTGTCCTCCATTTCAATCTCCATATTCTTTCTTTGGGAGGATGAGTGGTTTTCGT
TGAGCCGAGAGTGTATTAGAAACGGGCTCTTCCCAGACCGGGGATTGCTCTCTGTGTGTTGTTGTATATATATAGTTTGATATATTTTAC
ATTTTAAAGTTTTTTGGTGATGATTAGGAAAGCACTACCTATAATAATATTTTCCTAAGAAATTATTGAATGAGTGGTTGTTCTATCAAC
TTCAATTGCTGCATTATTTTCAGTAGTGGTCAATTCAATTTGCTGTAATGGCCTAATGCTCTTTGGAGAAAAATGATTTGCTTTAGAAAT
AACCAAATCATGATGGTTGTGCAGTAACAGTTAAAATCTGGAATTGATGAAATCTCA
(5')ATGGATATGAAAGGTAAGAAATTAACCAT
CATCGGAACAGTTGATCCAGTGAGTGTAGTGAGCAAACTTCGGAAATTTTGGCCAGCACACATAATCTCAGTAGGACCAGCGAAAGAGCC
AGAGAAGAAAGAGGAACCAAAGAAAGAAGAGGCCAAGAAAGAGGAGGCTAAGAAGGAGGGCGAGGGCAAGAAAGAAGACGCTCCGAAGGA
GGAAGGTAAGAAAGAGGAGGGTAAGAAGGAAGAAGAAGGTAAGAAGGATGAAAATAAGAAAGACGAGCCCAAAAAGGACGGAGAGAAGAA
GGCAGAACCACAGCCACAGCCACAGCCAATGCCGATGCCTATGCCATTCCCACATCATCAAGGCTATAATCAATCCGTGGTTGGXCATGG
TACCTTATCGGCCATACTATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan