ESTScan Details for Unigene SGN-U317728

Score 
312
Direction 
Reverse
Predicted Peptide Sequence 
MDRPCTSSIEEVRELFLQSSCPREFLLSRLQVTKSLPPAVCSPQQLDAIPHHRVLIEVMKQPWFNRLLCVIEERIPTNAHDHLVDTLPDS
PAHPKYTPAGVLKEWLNNLXGDKLAEKNIDPIRIEKHITVKSYRQDTNLPCPSNNWSSNPDNNLT
Predicted Coding Sequence 
ATGGATCGTCCTTGTACTTCAAGTATTGAGGAAGTTCGAGAGCTCTTTCTGCAATCTTCCTGTCCTCGTGAATTTTTGCTATCAAGGCTT
CAAGTGACGAAAAGTTTGCCTCCGGCCGTATGTAGCCCACAACAACTAGATGCAATTCCTCACCATAGAGTCCTCATTGAAGTCATGAAG
CAACCATGGTTCAATCGTCTTCTCTGTGTTATTGAAGAAAGGATTCCAACCAATGCTCATGACCATCTTGTAGACACCTTGCCTGATAGT
CCTGCCCATCCAAAATATACACCCGCTGGTGTTCTGAAAGAATGGCTGAATAACCTTGXTGGGGATAAATTAGCTGAAAAGAATATTGAC
CCCATAAGAATAGAAAAACACATCACTGTTAAGTCATACAGGCAAGATACTAATCTTCCATGCCCCTCCAACAATTGGAGTTCGAATCCA
GATAATAATTTGACATAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTATAAACAGACAGAAAACAAGTTACATTAATCAACATTTACACAGGAACTTGAAATTCTCAGTACAAAGATCCTGC
ACTTGAACCCTTTGCCATTCACTAATACCCCCTGGAAGGTTCTTTAACTTCTGAATAGCTATACATTCAAAAAAAATTATCTTTTTATTG
TATAGAGCATTCCACGCAATTTGATGGGGAGACACTATTGTAGTCTGAGGAATTAGGACAGAATAAACAGATACAATCCCAATTAGAACA
ATAATGAACTTCAACACTTCAATGATCAATTTTCTTGATTTTCTTGATGCAGAGAACTTTTAAGGT
(5')ATGGATCGTCCTTGTACTTC
AAGTATTGAGGAAGTTCGAGAGCTCTTTCTGCAATCTTCCTGTCCTCGTGAATTTTTGCTATCAAGGCTTCAAGTGACGAAAAGTTTGCC
TCCGGCCGTATGTAGCCCACAACAACTAGATGCAATTCCTCACCATAGaAGTCCTCATTGAAGTCATGAAGCAACCATGGTTCAATCGTC
TTCTCTGTGTTATTGAAGAAAGGATTCCAACCAATGCTCATGACCATCTTGTAGACACCTTGaCCTGATAGTCCTGCCCATCCAAAATAT
ACACCCGCTGGaTGTTCTGAAAGAATGGCTGAATAACCTTGXTGGGGATAAATTAGCTGAAAAGAATATTGACCCCATAAGAATAGAAAA
ACACATCACTGTTAAGTCATACgAGGCAAGATACTAATCTTCCATGCCCCTCCAACAATTGGAGTTCGAATCCAGATAATAATTTGACAT
AA(3')AAATCAATATCTCTGATATGACAGGCTCACAAGAAACTGAAATTCCAATAACAAACTTCTGAGAAATTCTCAAGTCATTTCAAG
TATACACAGATAACGAGTCAAGCATTTATTTTAGCCATTCAGCAGAAGGAATAAAGAAGACCGCATACCTGTGGGGATCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan