ESTScan Details for Unigene SGN-U317836

Score 
617
Direction 
Forward
Predicted Peptide Sequence 
MVSESDHDPTVQNDSSTSEQQLNDESSTSLQQQSSQTQQQQQQSSSSSSVPAVAGPRCAPTYSVVHEVIEKKEDGPGPRCGHTLTAVPAV
GEEGSPNYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCYDVFTNAVMDGFERFAQXAFDYSFFQPPITAGTANNAGA
ILALGRDLVVVPKLIHPIPPVSSPENSPERHIGDTWMQDLNANRPPTPTRGRPQVCERSX
Predicted Coding Sequence 
ATGGTATCGGAGTCCGATCACGATCCGACTGTTCAGAATGATAGTTCGACGTCGGAACAACAGCTTAATGATGAGTCTTCAACTTCGTTG
CAGCAGCAAAGTTCACAAACTCAGCAACAGCAGCAGCAAAGTAGTAGTAGTAGTAGTGTTCCTGCTGTTGCGGGACCAAGGTGTGCTCCG
ACGTATTCGGTGGTGCACGAAGTGATAGAGAAGAAGGAAGATGGTCCAGGGCCAAGGTGTGGGCATACGTTAACGGCTGTACCAGCTGTT
GGTGAAGAAGGTTCTCCTAATTATATTGGTCCAAGGCTTATTCTTTTTGGTGGTGCTACTGCTCTTGAGGGAAATTCTGCTGCTTCTGGA
ACCCCGTCTTCTGCTGGAAGTGCTGGAATTCGCTTAGCAGGGGCTACTGCTGATGTGCACTGTTATGATGTTTTCACGAATGCXGTGATG
GATGGCTTTGAAAGATTTGCTCAGGXGGCGTTTGATTACTCTTTTTTTCAGCCACCAATTACTGCXGGTACTGCTAACAATGCTGGTGCC
ATTTTAGCACTGGGTAGAGATCTTGTTGTGGTTCCAAAACTTATCCACCCAATTCCGCCAGTTTCATCGCCTGAAAATTCACCTGAACGG
CATATAGGAGACACTTGGATGCAGGACTTAAATGCTAACAGACCCCCTACACCAACCAGAGGCCGTCCCCAAGTTTGCGAACGATCGAXX
Edits in Original Sequence 
TATTATAGTATTGATATGGATGTGGATTCAACT(5')ATGGTATCGGAGTCCGATCACGATCCGACTGTTCAGAATGATAGTTCGACGTC
GGAACAACAGCTTAATGATGAGTCTTCAACTTCGTTGCAGCAGCAAAGTTCACAAACTCAGCAACAGCAGCAGCAAAGTAGTAGTAGTAG
TAGTGTTCCTGCTGTTGCGGGACCAAGGTGTGCTCCGACGTATTCGGTGGTGCACGAAGTGATAGAGAAGAAGGAAGATGGTCCAGGGCC
AAGGTGTGGGCATACGTTAACGGCTGTACCAGCTGTTGGTGAAGAAGGTTCTCCTAATTATATTGGTCCAAGGCTTATTCTTTTTGGTaG
GTGCTACTGCTCTTGAGGGAAATTCTGCTGCTTCTGGAACCCCGTCTTCTGCTGGAAGTGCTGGAATTCGCTTAGCAGGGGCTACTGCTG
ATGTGCACTGTTATGATGTTTTCACGAATGCXGTGATGGATGGCTTTGAAAGATTTGCTCAGGXGGCGTTTGATTACTCTTTTTTTCAGC
CACCAATTACTGCXGGTACTGCTAACAATGCTGGTGCCATTTTAGCACTGGGTAGAGATCTTGTTGTGGTTCCAAAACTTATCCACCCAA
TTCCGCCAGTTTCATCGCCTGAAAATTCACCTGAACGGCATATAGGAGACACTTGGATGCAGGACTTAAATGCTAACAGACCCCCTACAC
CAACCAGAGGCCGTCCCCAAGTTTGCGAACGATCGAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan